TRAP1 Antibody - N-terminal region (ARP30183_P050)

Catalog#: ARP30183_P050

• Size: 50ug

Human HeLa

• Description of Target: Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
• Gene Symbol: TRAP1
• Alias Symbols: HSP75; HSP90L
• Protein Accession#: NP_057376
• Nucleotide Accession#: NM_016292
• Swissprot Id: Q12931
• Host: Rabbit
• Protein Size (# AA): 704
• Molecular Weight: 80kDa
• Application: WB
• Partner Proteins: EXT1,EXT2,RB1,SMAD4,TGFBR1,TGFBR2,TLR1,TLR6,TNFRSF1A,AI837181,EXT1,EXT2,H2AFX,HDAC5,HGS,RAD21,RB1,RYK,SF3A2,SUMO2,TNFRSF1A,UBC
• Immunogen: The immunogen for Anti-TRAP1 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAP1
• Product Format: Lyophilized powder
• Peptide Sequence: Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
• Blocking Peptide: Catalog # AAP30183
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final Anti-TRAP1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.