SEC61A1 Antibody - C-terminal region (ARP65273_P050)

Catalog#: ARP65273_P050

• Size: 50ug

Human HT1080

• Description of Target: The protein encoded by this gene belongs to the SECY/SEC61- alpha family. It appears to play a crucial role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. This protein found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins. This gene encodes an alpha subunit of the heteromeric SEC61 complex, which also contains beta and gamma subunits.
• Gene Symbol: SEC61A1
• Alias Symbols: HSEC61; SEC61; SEC61A
• Protein Accession#: NP_037468
• Nucleotide Accession#: NM_013336
• Swissprot Id: P61619
• Host: Rabbit
• Protein Size (# AA): 476
• Molecular Weight: 52kDa
• Application: WB
• Subunit: alpha isoform 1
• Partner Proteins: SEC61A1,SERP1,AP1S1,APOB,NDN,SUMO2,TMEM173,UBC,USP11,USP19
• Immunogen: The immunogen for Anti-SEC61A1 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC61A1
• Product Format: Lyophilized powder
• Peptide Sequence: Synthetic peptide located within the following region: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC
• Blocking Peptide: Catalog # AAP65273
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final Anti-SEC61A1 Antibody (ARP65273_P050) concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.