NAPA Antibody - N-terminal region (AVARP13049_T100)

Catalog No: AVARP13049_T100

Product Info

• Predicted Species Reactivity: Mouse, Cow, Dog, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NAPA
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Mouse: 78%; Zebrafish: 78%
• Peptide Sequence: Synthetic peptide located within the following region: MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-NAPA (AVARP13049_T100) antibody is Catalog # AAP30724 (Previous Catalog # AAPP01381)
• Reference: Lemons, P.P., et al., (1997) Blood 90 (4), 1490-1500.

Target Info

• Gene Symbol: NAPA
• Gene Full Name: N-ethylmaleimide-sensitive factor attachment protein, alpha
• Alias Symbols: SNAPA
• NCBI Gene Id: 8775
• Protein Name: Alpha-soluble NSF attachment protein
• Description of Target: The 'SNARE hypothesis' is a model explaining the process of docking and fusion of vesicles to their target membranes. According to this model, membrane proteins from the vesicle (v-SNAREs) and proteins from the target membrane (t-SNAREs) govern the specificity of vesicle targeting and docking through mutual recognition. Once the 2 classes of SNAREs bind to each other, they form a complex that recruits the general elements of the fusion apparatus, namely NSF (N-ethylmaleimide-sensitive factor) and SNAPs (soluble NSF-attachment proteins), to the site of membrane fusion, thereby forming the 20S fusion complex. Alpha- and gamma-SNAP are found in a wide range of tissues and act synergistically in intra-Golgi transport. The sequence of the predicted 295-amino acid human protein encoded by NAPA shares 37%, 60%, and 67% identity with the sequences of yeast, Drosophila, and squid alpha-SNAP, respectively.
• Uniprot ID: P54920
• Protein Accession #: NP_003818
• Nucleotide Accession #: NM_003827
• Protein Size (# AA): 295
• Molecular Weight: 33kDa
• Protein Interactions: UBC; RPA3; RPA2; RPA1; RNF2; ATP4A; STX5; ITGA4; FN1; VCAM1; VCP; DHX40; DHX29; THUMPD3; STAM2; VAMP2; APP; NSF; TRPC3; RTN4; STX12; GNA12; STX8; GOSR2; GOSR1; BNIP1; STX7; VAMP8; SNAP23; STX4; STX1A; SNAP25;