SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP74402_P050
Price: $0.00
SKU
ARP74402_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATF7 (ARP74402_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human ATF7
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: GYDPLHPTLPSPTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATF7 (ARP74402_P050) antibody is Catalog # AAP74402
Gene SymbolATF7
Alias SymbolsATFA
NCBI Gene Id11016
Description of TargetIsoform 5/ATF-4 acts as a negative regulator, inhibiting both ATF2 and ATF7 transcriptional activities. It may exert these effects by sequestrating in the cytoplasm the Thr-53 phosphorylating kinase, preventing activation. FUNCTION: Isoform 4/ATF-A0 acts as a dominant repressor of the E- selectin/NF-ELAM1/delta-A promoter.ATF7 Plays important functions in early cell signaling. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]- 3'), a sequence present in many viral and cellular promoters. Activator of the NF-ELAM1/delta-A site of the E-selectin promoter. Has no intrinsic transcriptional activity, but activates transcription on formation of JUN or FOS heterodimers. Also can bind TRE promoter sequences when heterodimerized with members of the JUN family.
Uniprot IDP17544-3
Protein Size (# AA)473
Molecular Weight52kDa
Protein InteractionsFCER2; TMEM239; FAM9B; CCDC155; MITD1; OCIAD1; TAOK3; URI1; MAPK8; UBC; CREB1; Cebpb; SUMO2; YY1; BCL6; TAF12; TAF4; MAPK9; PTP4A1; PTP4A2; FOS; ATF2; JDP2;
  1. What is the species homology for "ATF7 Antibody - middle region (ARP74402_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ATF7 Antibody - middle region (ARP74402_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATF7 Antibody - middle region (ARP74402_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATF7 Antibody - middle region (ARP74402_P050)"?

    This target may also be called "ATFA" in publications.

  5. What is the shipping cost for "ATF7 Antibody - middle region (ARP74402_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATF7 Antibody - middle region (ARP74402_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATF7 Antibody - middle region (ARP74402_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATF7 Antibody - middle region (ARP74402_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATF7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATF7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATF7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATF7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATF7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATF7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATF7 Antibody - middle region (ARP74402_P050)
Your Rating
We found other products you might like!