- Description of Target:
- MTFMT formylates methionyl-tRNA in mitochondria. A single tRNA(Met) gene gives rise to both an initiator and an elongator species via an unknown mechanism.
- Gene Symbol:
- MTFMT
- Official Gene Full Name:
- Mitochondrial methionyl-tRNA formyltransferase
- Alias Symbols:
- FMT1
- Tissue Tool:
- Find tissues and cell lines supported to express MTFMT.
- Protein Accession# :
- NP_640335
- Nucleotide Accession#:
- NM_139242
- Swissprot Id:
- Q96DP5
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 304
- Molecular Weight:
- 34kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-MTFMT antibody: synthetic peptide directed towards the C terminal of human MTFMT
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- MTFMT antibody - C-terminal region (ARP49013_P050)
- Predicted Homology Based on Immunogen Sequence:
- Pig: 84%
- Datasheets / Downloads:
- Printable datasheet for
anti-MTFMT antibody
- ARP49013_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: SVMLKKSLTATDFYNGYLHPWYQKNSQAQPSQCRFQTLRLPTKKKQKKTV
- Blocking Peptide:
- For anti-MTFMT antibody is Catalog # AAP49013 (Previous Catalog # AAPY02168)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-MTFMT antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: MTFMT antibody tested with Human Fetal Liver Tissue (ARP49013_P050)
Aviva Systems Biology is the original manufacturer of this MTFMT antibody (ARP49013_P050)
Click here to view the MTFMT antibody Western Blot Protocol
Product Datasheet Link: MTFMT antibody (ARP49013_P050)
WB Suggested Anti-MTFMT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Liver
Western Blot image: 
Description of Target: MTFMT formylates methionyl-tRNA in mitochondria. A single tRNA(Met) gene gives rise to both an initiator and an elongator species via an unknown mechanism.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s MTFMT antibody (ARP49013_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
