SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31541_P050
Price: $0.00
SKU
ARP31541_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

4930567H17Rik Antibody - middle region (ARP31541_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-4930567H17Rik (ARP31541_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-4930567H17Rik (ARP31541_P050) antibody is Catalog # AAP31541
Gene Symbol4930567H17Rik
Gene Full NameRIKEN cDNA 4930567H17 gene
Alias Symbols-
NCBI Gene Id619303
Protein NameProtein 4930567H17Rik Ensembl ENSMUSP00000090060
Description of TargetThe function of this protein remains unknown.
Uniprot IDQ3V0K5
Protein Accession #NP_001028979
Nucleotide Accession #NM_001033807
Protein Size (# AA)233
Molecular Weight27kDa
  1. What is the species homology for "4930567H17Rik Antibody - middle region (ARP31541_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "4930567H17Rik Antibody - middle region (ARP31541_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "4930567H17Rik Antibody - middle region (ARP31541_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "4930567H17Rik Antibody - middle region (ARP31541_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "4930567H17Rik Antibody - middle region (ARP31541_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "4930567H17Rik Antibody - middle region (ARP31541_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "4930567H17Rik Antibody - middle region (ARP31541_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "4930567H17Rik Antibody - middle region (ARP31541_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "4930567H17RIK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "4930567H17RIK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "4930567H17RIK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "4930567H17RIK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "4930567H17RIK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "4930567H17RIK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:4930567H17Rik Antibody - middle region (ARP31541_P050)
Your Rating