website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

MEOX2 antibody - N-terminal region (ARP32698_T100)

Description of Target:
MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.
Gene Symbol:
Official Gene Full Name:
Mesenchyme homeobox 2
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express MEOX2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
MEOX2 protein EMBL CAG38790.1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-MEOX2 antibody: synthetic peptide directed towards the N terminal of human MEOX2
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
MEOX2 antibody - N-terminal region (ARP32698_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%
Species Reactivity:
Human, Bovine, Dog, Pig, Rabbit, Rat, Mouse, Horse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MEOX2 antibody
- ARP32698_T100
Peptide Sequence:
Synthetic peptide located within the following region: ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQ
Blocking Peptide:
For anti-MEOX2 antibody is Catalog # AAP32698 (Previous Catalog # AAPP03712)
Target Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-MEOX2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for MEOX2 antibody (ARP32698)

Product page for MEOX2 antibody (ARP32698)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog MEOX2 antibody; Xenopus laevis MEOX2 antibody P39021 85%
African clawed frog meox2-a antibody; Xenopus laevis meox2-a antibody Q7ZXL2 85%
African elephant LOC100665957 antibody; Loxodonta africana LOC100665957 antibody G3UDR4 100%
African elephant MEOX2 antibody; Loxodonta africana MEOX2 antibody G3TZZ0 100%
Bovine MEOX2 antibody; Bos taurus MEOX2 antibody A5D7C5 100%
Chicken MEOX2 antibody; Gallus gallus MEOX2 antibody Q90YH7 92%
Chicken MEOX2 antibody; Gallus gallus MEOX2 antibody F1NM26 92%
Chinese hamster LOC100753046 antibody; Cricetulus griseus LOC100753046 antibody G3HN92 100%
Common turkey LOC100545270 antibody; Meleagris gallopavo LOC100545270 antibody G1NCH1 92%
Dog MEOX2 antibody; Canis familiaris MEOX2 antibody E2RDU9 100%
Giant panda LOC100476458 antibody; Ailuropoda melanoleuca LOC100476458 antibody D2H6P7 100%
Gray short-tailed opossum MEOX2 antibody; Monodelphis domestica MEOX2 antibody F6T730 100%
Green anole LOC100556393 antibody; Anolis carolinensis LOC100556393 antibody G1KMW8 90%
Guinea pig LOC100719225 antibody; Cavia porcellus LOC100719225 antibody H0W094 92%
Horse LOC100052826 antibody; Equus caballus LOC100052826 antibody F6Q253 92%
Human MEOX2 antibody; Homo sapiens MEOX2 antibody P50222 100%
Human MEOX2 antibody; Homo sapiens MEOX2 antibody Q6FHY5 100%
Human MEOX2 antibody; Homo sapiens MEOX2 antibody A4D127 100%
Little brown bat MEOX2 antibody; Myotis lucifugus MEOX2 antibody G1Q6E9 100%
Lowland gorilla MEOX2 antibody; Gorilla gorilla gorilla MEOX2 antibody G3S7C0 100%
Lowland gorilla MEOX2 antibody; Gorilla gorilla gorilla MEOX2 antibody G3QTT1 100%
Mouse MEOX2 antibody; Mus musculus MEOX2 antibody P32443 100%
Mouse Meox2 antibody; Mus musculus Meox2 antibody Q99M23 100%
Northern white-cheeked gibbon LOC100598707 antibody; Nomascus leucogenys LOC100598707 antibody G1S2X0 100%
Pig GAX antibody; Sus scrofa GAX antibody F1SEJ3 100%
Pig MEOX2 antibody; Sus scrofa MEOX2 antibody Q95JA6 100%
Rabbit LOC100355333 antibody; Oryctolagus cuniculus LOC100355333 antibody G1TP72 100%
Rabbit MEOX2 antibody; Oryctolagus cuniculus MEOX2 antibody G1TJS8 100%
Rat MEOX2 antibody; Rattus norvegicus MEOX2 antibody P39020 100%
Rat Meox2 antibody; Rattus norvegicus Meox2 antibody G3V6T9 100%
Rhesus macaque MEOX2 antibody; Macaca mulatta MEOX2 antibody F7C188 100%
Small-eared galago MEOX2 antibody; Otolemur garnettii MEOX2 antibody H0XXX9 92%
Western clawed frog meox2 antibody; Xenopus tropicalis meox2 antibody F6UCR5 85%
Western clawed frog meox2 antibody; Xenopus tropicalis meox2 antibody B1H161 85%
White-tufted-ear marmoset LOC100393185 antibody; Callithrix jacchus LOC100393185 antibody F6YFV9 100%
White-tufted-ear marmoset LOC100393185 antibody; Callithrix jacchus LOC100393185 antibody F6YFS8 100%
Zebra finch LOC100219741 antibody; Taeniopygia guttata LOC100219741 antibody H0YWD9 92%

Product Protocols: MEOX2 antibody tested with Human Transfected 293T Cells (ARP32698_T100)

Aviva Systems Biology is the original manufacturer of this MEOX2 antibody (ARP32698_T100)

Click here to view the MEOX2 antibody Western Blot Protocol

Product Datasheet Link: MEOX2 antibody (ARP32698_T100)

WB Suggested Anti-MEOX2 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T

Western Blot image:

Description of Target: MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s MEOX2 antibody (ARP32698_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question