website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

MEOX2 antibody - N-terminal region (ARP32698_T100)

Description of Target:
MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.
Gene Symbol:
MEOX2
Official Gene Full Name:
Mesenchyme homeobox 2
NCBI Gene Id:
4223
Alias Symbols:
GAX; MOX2
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MEOX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MEOX2.
Swissprot Id:
Q6FHY5
Protein Accession #:
NP_005915
Nucleotide Accession #:
NM_005924
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
MEOX2 protein EMBL CAG38790.1
Protein Size (# AA):
303
Molecular Weight:
33kDa
Application:
WB
Protein Interactions:
ZNF564; ZNF483; TTC39B; LOC153684; ZMAT2; ZNF417; KRT80; DYNLL2; ZNF572; AHSA2; HEXIM2; MSI2; CIB3; MRFAP1L1; IGFN1; TRIM41; KLC4; FBF1; KRTAP4-2; KRTAP4-7; MUM1; ZNF587; PGBD1; EIF1AD; HDHD2; NCALD; KRTAP9-2; TTC25; ADAMTS12; DOCK8; ZNF329; SCNM1; RMND5A
Immunogen:
The immunogen for anti-MEOX2 antibody: synthetic peptide directed towards the N terminal of human MEOX2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
MEOX2 antibody - N-terminal region (ARP32698_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%
Species Reactivity:
Human, Bovine, Dog, Pig, Rabbit, Rat, Mouse, Horse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MEOX2 antibody
- ARP32698_T100
Peptide Sequence:
Synthetic peptide located within the following region: ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQ
Blocking Peptide:
For anti-MEOX2 antibody is Catalog # AAP32698 (Previous Catalog # AAPP03712)
Target Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: MEOX2 antibody tested with Human Transfected 293T Cells (ARP32698_T100)

Aviva Systems Biology is the original manufacturer of this MEOX2 antibody (ARP32698_T100)

Click here to view the MEOX2 antibody Western Blot Protocol

Product Datasheet Link: MEOX2 antibody (ARP32698_T100)

WB Suggested Anti-MEOX2 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T

Western Blot image:


Description of Target: MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MEOX2 antibody (ARP32698_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question