website statistics

Aviva Systems Biology office will be closed for Independence Day - July 4th, 2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MEOX2 antibody - N-terminal region (ARP32698_T100)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP32698_T100-FITC Conjugated

ARP32698_T100-HRP Conjugated

ARP32698_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mesenchyme homeobox 2
Protein Name:
MEOX2 protein EMBL CAG38790.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MEOX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MEOX2.
The immunogen is a synthetic peptide directed towards the N terminal region of human MEOX2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MEOX2 (ARP32698_T100)
Peptide Sequence:
Synthetic peptide located within the following region: ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MEOX2 (ARP32698_T100) antibody is Catalog # AAP32698 (Previous Catalog # AAPP03712)
Datasheets / Downloads:
Printable datasheet for anti-MEOX2 (ARP32698_T100) antibody
Target Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65

Product Protocols: MEOX2 antibody tested with Human Transfected 293T Cells (ARP32698_T100)

Aviva Systems Biology is the original manufacturer of this MEOX2 antibody (ARP32698_T100)

Click here to view the MEOX2 antibody Western Blot Protocol

Product Datasheet Link: MEOX2 antibody (ARP32698_T100)

WB Suggested Anti-MEOX2 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T

Western Blot image:

Description of Target: MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s MEOX2 antibody (ARP32698_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...