website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

MEOX2 antibody - N-terminal region (ARP32698_T100)

Description of Target:
MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.
Gene Symbol:
MEOX2
Official Gene Full Name:
Mesenchyme homeobox 2
NCBI Gene Id:
4223
Alias Symbols:
GAX; MOX2
Tissue Tool:
Find tissues and cell lines supported to express MEOX2.
Protein Accession #:
NP_005915
Nucleotide Accession#:
NM_005924
Swissprot Id:
Q6FHY5
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
MEOX2 protein EMBL CAG38790.1
Protein Size (# AA):
303
Molecular Weight:
33kDa
Application:
WB
Partner Proteins:
AFF1, AFF4, ARID1A, CBX8, MLLT10, CBX8
Immunogen:
The immunogen for anti-MEOX2 antibody: synthetic peptide directed towards the N terminal of human MEOX2
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
MEOX2 antibody - N-terminal region (ARP32698_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%
Species Reactivity:
Human, Bovine, Dog, Pig, Rabbit, Rat, Mouse, Horse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MEOX2 antibody
- ARP32698_T100
Peptide Sequence:
Synthetic peptide located within the following region: ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQ
Blocking Peptide:
For anti-MEOX2 antibody is Catalog # AAP32698 (Previous Catalog # AAPP03712)
Key Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-MEOX2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question