- Description of Target:
- The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
- Gene Symbol:
- TFAM
- Official Gene Full Name:
- Transcription factor A, mitochondrial
- Alias Symbols:
- TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3
- Tissue Tool:
- Find tissues and cell lines supported to express TFAM.

- Protein Accession# :
- NP_003192
- Nucleotide Accession#:
- NM_003201
- Swissprot Id:
- Q00059
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 246
- Molecular Weight:
- 29kDa
- Application:
- WB
- Partner Proteins:
- MAX, MYC, SIN3A, SIN3B, SMC3, MAX, SMC3
- Immunogen:
- The immunogen for anti-TFAM antibody: synthetic peptide directed towards the N terminal of human TFAM
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- TFAM antibody - N-terminal region (ARP31400_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Bovine: 91%; Horse: 91%; Pig: 91%; Dog: 83%; Rabbit: 83%; Guinea pig: 75%; Mouse: 75%
- Datasheets / Downloads:
- Printable datasheet for
anti-TFAM antibody
- ARP31400_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
- Blocking Peptide:
- For anti-TFAM antibody is Catalog # AAP31400 (Previous Catalog # AAPP03075)
- Key Reference:
- Cruzen,M.E., Gene 362, 125-132 (2005)
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-TFAM antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Customer Reviews for TFAM Antibody (ARP31400_P050) tested with bEND3 cell lysate in Western blot
CAT# ARP31400_P050
TFAM antibody bEnd.3 cell line
submitted by:
Martin Kemper
University of California Irvine
Product Protocols: TFAM antibody tested with Human Jurkat Cells (ARP31400_P050)
Aviva Systems Biology is the original manufacturer of this TFAM antibody (ARP31400_P050)
Click here to view the TFAM antibody Western Blot Protocol
Product Datasheet Link: TFAM antibody (ARP31400_P050)
WB Suggested Anti-TFAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat
Western Blot image: 
Description of Target: The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s TFAM antibody (ARP31400_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Review: TFAM antibody-N-terminal region (ARP31400_P050) in HepG2, Hep3B and K562 cells using Western Blot
Product Page for TFAM antibody-N-terminal region (ARP31400_P050)
Application: Western blotting
Species+tissue/cell type: HepG2, Hep3B and K562 cells
How many ug’s of tissue/cell lysate run on the gel:
1: HepG2 cell lysate
2: HepG2 cell lysate
3: Hep3B cell lysate
4: Hep3B cell lysate
5: K562 cell lysate
6: K562 cell lysate
Primary antibody dilution: 1:1000
Secondary antibody:
Secondary antibody dilution: 1:1000
Questionnaire:
1. How do Aviva’s reagents play a role in your experimental goals?
--Used it for WESTERN BLOT.
2. How many different experimental trials were conducted using the antibody sample?
-- SEVERAL.
3. What type of experimental sample are you using and how did you prepare it?
-- Total Cell Lysates prepared by sonication in MSB buffer (Mannitol, Sucrose Buffer) .
4. What applications did you test the antibody in? Please include dilutions of the primary and secondary reagents.
-- Used it for WESTERN BLOT. Dilution for primary antibody (TFAM 1ug/ml) and for secondary antibody 1:1000.
5. What controls were used in your experiment? Please include your positive control.
-- No positive control.
6. For IHC, what antigen retrieval method did you use?
-- NA—
7. How did you store the antibody after re-suspension?
-- @ -20 degree Celsius
8. Please provide the protocol for your application procedure. Please be as detailed as possible.
-- Standard SDS-PAGE protocol is used to run the protein samples.
-- Blocking is done in 10% non-fat dry milk
-- Primary antibody was made in 5% BSA and incubated overnight
-- HRP-conjugated secondary antibody is also diluted in 5% BSA and incubated for 1hr
-- ECL substrate is used to develop and film exposure time is 10 sec.
10. How would you rate this antibody on a scale from 1-5? Why?
Very Good (Scale 1). It gave single band with no background at expected size.
11. Would you use this antibody in future experiments?
Yes.
12. Please explain any problems you had with the antibody and/or experimental results that Aviva can address in the future.
TFAM antibody is OK.
13. Have you used another antibody which has worked in your application?
NO.
14. Do you believe the information about the reagent on Aviva’s website is correct?
YES.
15. If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?
We will be using it in future experiments.
- Protocol:
- Tips Information:
See our General FAQ page.



