TBX20 antibody - N-terminal region (ARP33177_P050)

Catalog#: ARP33177_P050

• Size: 50ug

Human HepG2

Human Muscle

Human kidney

• Description of Target: TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.
• Gene Symbol: TBX20
• Official Gene Full Name: T-box 20
• Alias Symbols: ASD4
• Protein Accession#: NP_065150
• Nucleotide Accession#: NM_020417
• Swissprot Id: Q9UMR3
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 447
• Molecular Weight: 49kDa
• Application: WB, IHC
• Immunogen: The immunogen for anti-TBX20 antibody: synthetic peptide directed towards the N terminal of human TBX20
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS
• Blocking Peptide: For anti-TBX20 antibody is Catalog # AAP33177 (Previous Catalog # AAPP04214)
• Key Reference: Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-TBX20 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Product Protocols: TBX20 antibody tested with Human Hepg2 Cells (ARP33177_P050)

Aviva Systems Biology is the original manufacturer of this TBX20 antibody (ARP33177_P050)

Click here to view the TBX20 antibody Western Blot Protocol

Product Datasheet Link: TBX20 antibody (ARP33177_P050)

WB Suggested Anti-TBX20 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:


Description of Target: TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TBX20 antibody (ARP33177_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: TBX20 antibody tested by IHC with human muscle (ARP33177)

Aviva Systems Biology is the original manufacturer of this TBX20 antibody.

Click here to view the TBX20 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TBX20 antibody (ARP33177)

IHC Information:

Rabbit Anti-TBX20 Antibody
Catalog Number: ARP33177
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: TBX20 antibody tested by IHC with human kidney (arp33177)

Aviva Systems Biology is the original manufacturer of this TBX20 antibody.

Click here to view the TBX20 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TBX20 antibody (arp33177)

IHC Information:

Rabbit Anti-TBX20 Antibody
Catalog Number: arp33177
Paraffin Embedded Tissue: Human Kidney
Antibody Concentration: 5 ug/ml

IHC Image: