Nkx2-5 antibody - N-terminal region (ARP31575_P050)

Catalog#: ARP31575_P050

• Size: 50ug

Human MCF-7

• Description of Target: Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1211 U34962.1 1-1211 1212-1585 BC025711.1 1143-1516
• Gene Symbol: Nkx2-5
• Official Gene Full Name: NK2 homeobox 5
• Alias Symbols: CSX; CSX1; NKX2.5; NKX2E; NKX4-1; VSD3; CHNG5; HLHS2
• Protein Accession#: NP_004378
• Nucleotide Accession#: NM_004387
• Swissprot Id: P52952
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 324
• Molecular Weight: 35kDa
• Application: WB
• Immunogen: The immunogen for anti-Nkx2-5 antibody: synthetic peptide directed towards the n terminal of human Nkx2-5
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 92%; Rat: 92%; Guinea pig: 91%; Bovine: 84%; Dog: 84%; Rabbit: 76%
• Peptide Sequence: Synthetic peptide located within the following region: ELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVE
• Blocking Peptide: For anti-Nkx2-5 antibody is Catalog # AAP31575 (Previous Catalog # AAPP02354)
• Key Reference: Nagel,S., (2008) Leukemia 22 (3), 600-607
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-Nkx2-5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: Nkx2-5 antibody tested with Human Mcf7 Cells (ARP31575_P050)

Aviva Systems Biology is the original manufacturer of this Nkx2-5 antibody (ARP31575_P050)

Click here to view the Nkx2-5 antibody Western Blot Protocol

Product Datasheet Link: Nkx2-5 antibody (ARP31575_P050)

WB Suggested Anti-Nkx2-5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7

Western Blot image:


Description of Target: Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1211 U34962.1 1-1211 1212-1585 BC025711.1 1143-1516

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s Nkx2-5 antibody (ARP31575_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com