- Description of Target:
- LTB4R is the receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. LTB4R may be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. LTB4R is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
- Gene Symbol:
- LTB4R
- Official Gene Full Name:
- Leukotriene B4 receptor
- Alias Symbols:
- BLT1; BLTR; CMKRL1; GPR16; LTB4R1; LTBR1; P2RY7; P2Y7
- Tissue Tool:
- Find tissues and cell lines supported to express LTB4R.
- Protein Accession# :
- NP_858043
- Nucleotide Accession#:
- NM_181657
- Swissprot Id:
- Q15722
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 352
- Molecular Weight:
- 37kDa
- Application:
- WB
- Partner Proteins:
- GNA15, GRK6
- Immunogen:
- The immunogen for anti-LTB4R antibody: synthetic peptide directed towards the C terminal of human LTB4R
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- LTB4R antibody - C-terminal region (ARP30823_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-LTB4R antibody
- ARP30823_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG
- Blocking Peptide:
- For anti-LTB4R antibody is Catalog # AAP30823 (Previous Catalog # AAPP24010)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-LTB4R antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: LTB4R antibody tested with Human Panc1 Cells (ARP30823_P050)
Aviva Systems Biology is the original manufacturer of this LTB4R antibody (ARP30823_P050)
Click here to view the LTB4R antibody Western Blot Protocol
Product Datasheet Link: LTB4R antibody (ARP30823_P050)
WB Suggested Anti-LTB4R Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1
Western Blot image: 
Description of Target: LTB4R is the receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. LTB4R may be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. LTB4R is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s LTB4R antibody (ARP30823_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
