CCL16 antibody - N-terminal region (ARP30780_P050)

Catalog#: ARP30780_P050

• Size: 50ug

Human 721_B

• Description of Target: CCL16 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL16 displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10.
• Gene Symbol: CCL16
• Official Gene Full Name: Chemokine (C-C motif) ligand 16
• Alias Symbols: CKb12; HCC-4; ILINCK; LCC-1; LEC; LMC; MGC117051; Mtn-1; NCC-4; NCC4; SCYA16; SCYL4
• Protein Accession#: NP_004581
• Nucleotide Accession#: NM_004590
• Swissprot Id: O15467
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 120
• Molecular Weight: 11kDa
• Application: WB
• Partner Proteins: CCR1, CCR2, CCR5, CCR8, HRH4
• Immunogen: The immunogen for anti-CCL16 antibody: synthetic peptide directed towards the N terminal of human CCL16
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL
• Blocking Peptide: For anti-CCL16 antibody is Catalog # AAPP48326
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-CCL16 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.