- Description of Target:
- YWHAE,tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide,MDS; MDCR; KCIP-1; 14-3-3E; FLJ45465; FLJ53559; YWHAE,14-3-3 protein epsilon,14-3-3 protein epsilon,14-3-3 epsilon,protein kinase C inhibitor protein-1,mitoc.
- Gene Symbol:
- YWHAE
- Official Gene Full Name:
- Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
- Alias Symbols:
- 14-3-3E; FLJ45465; FLJ53559; KCIP-1; MDCR; MDS
- Tissue Tool:
- Find tissues and cell lines supported to express YWHAE.

- Protein Accession# :
- NP_006752
- Nucleotide Accession#:
- NM_006761
- Swissprot Id:
- P62258
- Host:
- Rabbit
- Protein Size (# AA):
- 255
- Molecular Weight:
- 29kDa
- Application:
- WB
- Partner Proteins:
- BIRC3,CDC25A,CDC25B,CDK11B,HCVgp1,IGF1R,IRS1,NCOR2,RAF1,TSC1,TSC2,ABL1,AKAP13,ARHGEF2,ATXN1,BAD,BCR,CALM1,CASP3,CDC25A,CDC25B,CDK11B,CDK14,CDK16,CDKN1B,DYRK1A,GPRIN2,GRAP2,HDAC4,HDAC5,HSF1,IGF1R,ING1,IRS1,IRS2,KCNH2,KCNK15,KCNK3,KCNK9,KIF1C,KRT18,MAP3K10,MAP3K2,MAP3K3,MAP3K5,MDM4,MST1R,NCOR2,NDEL1,NGFRAP1,PAPOLA,PRKCG,RAF1,RASGRF1,REM1,RGNEF,RGS3,RIN1,RPGR,SLC8A1,SLC8A2,SLC8A3,SNCA,SORBS2,SRC,TAZ,TFDP2,TGFB1,TNFAIP3,TOP2A,TSC1,TSC2,VIM,WWTR1,YWHAB,YWHAG,YWHAH,YWHAZ,ANKHD1-EIF4EBP3,ARAF,BAD,C16orf48,CAP2,CDC25A,CDC25B,CDC25C,CEP95,CGNL1,CHAF1A,COX2,EMD,EXO1,FAM13B,FAN1,FOXO3,GPRIN2,GRAP2,HDAC4,HDAC5,HDAC7,HDAC9,HIVEP2,IGF1R,ING1,IRS1,KCNH2,KIAA0232,LRMP,MAP3K1,MAP3K10,MAP3K2,MAP3K3,MAPK7,MDM4,MSL2,MYH10,NDEL1,NGFRAP1,PNLIP,POLR3H,RAF1,RAP1GAP2,RASAL3,REM1,SAMSN1,SH3BP4,SORBS2,SRRM2,SSFA2,SYN2,TBC1D3F,TGFB1,TLK1,TNFAIP3,TOP2A,USP43,Usp8,WNK1,WWTR1,YWHAB,YWHAG,YWHAH,YWHAQ,YWHAZ,ZNF839
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- YWHAE antibody - C-terminal region (ARP30642_P050)
- Predicted Homology Based on Immunogen Sequence:
- Chicken: 100%; Dog: 100%; Guinea pig: 100%; Mouse: 100%; Zebrafish: 100%; African clawed frog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-YWHAE antibody
- ARP30642_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN
- Blocking Peptide:
- For anti-YWHAE antibody is Catalog # AAPP41848
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-YWHAE antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.


