website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

US

TNFRSF10A antibody - C-terminal region (ARP30622_P050)

  • Catalog#: ARP30622_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    TNFRSF10A
    NCBI Gene Id:
    8797
    Official Gene Full Name:
    Tumor necrosis factor receptor superfamily, member 10a
    Protein Name:
    Tumor necrosis factor receptor superfamily member 10A
    Swissprot Id:
    O00220
    Protein Accession #:
    NP_003835
    Nucleotide Accession #:
    NM_003844
    Alias Symbols:
    APO2, CD261, DR4, MGC9365, TRAILR-1, TRAILR1
    Description of Target:
    This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.
    Protein Size (# AA):
    468
    Molecular Weight:
    50kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TNFRSF10A.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF10A.
    Species Reactivity:
    Human, Mouse
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%; Mouse: 80%
    Complete computational species homology data:
    Anti-TNFRSF10A (ARP30622_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; MARCH8; MARCH1; CFLAR; FADD; CUL3; TRAF2; CASP8; SQSTM1; TNFRSF10B; CBL; MOAP1; RASSF1; TNFRSF10D; TNFRSF10A; TNFSF10; MADD; BCL10; TRADD; RIPK1; DAP3; BTK; CD4; COL2A1; CASP10;
    Blocking Peptide:
    For anti-TNFRSF10A (ARP30622_P050) antibody is Catalog # AAP30622
    Datasheets / Downloads:
    Printable datasheet for anti-TNFRSF10A (ARP30622_P050) antibody
     
    X
    Ask a Question