TNFRSF10A antibody - C-terminal region (ARP30622_P050)

Catalog#: ARP30622_P050

• Size: 50ug

Human ACHN

• Description of Target: This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.
• Gene Symbol: TNFRSF10A
• Official Gene Full Name: Tumor necrosis factor receptor superfamily, member 10a
• Alias Symbols: APO2; CD261; DR4; MGC9365; TRAILR-1; TRAILR1
• Protein Accession#: NP_003835
• Nucleotide Accession#: NM_003844
• Swissprot Id: O00220
• Host: Rabbit
• Protein Size (# AA): 468
• Molecular Weight: 50kDa
• Application: WB
• Partner Proteins: MOAP1,RASSF1,BCL10,BTK,CASP8,CD4,COL2A1,DAP3,FADD,MADD,MOAP1,RASSF1,RIPK1,TNFRSF10A,TNFRSF10B,TNFRSF10D,TNFSF10,TRADD,BCL10,CASP10,CASP8,CBL,CFLAR,DAP3,FADD,TNFSF10,TRADD,UBC
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
• Blocking Peptide: For anti-TNFRSF10A antibody is Catalog # AAP30622
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-TNFRSF10A antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.