website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

TNFRSF10A antibody - C-terminal region (ARP30622_P050)

  • Catalog#: ARP30622_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP30622_P050-FITC Conjugated

    ARP30622_P050-HRP Conjugated

    ARP30622_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Tumor necrosis factor receptor superfamily, member 10a
    Protein Name:
    Tumor necrosis factor receptor superfamily member 10A
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    APO2, CD261, DR4, MGC9365, TRAILR-1, TRAILR1
    Replacement Item:
    This antibody may replace item sc-173513 from Santa Cruz Biotechnology.
    Description of Target:
    This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express TNFRSF10A.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF10A.
    Species Reactivity:
    Human, Mouse
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%; Mouse: 80%
    Complete computational species homology data:
    Anti-TNFRSF10A (ARP30622_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-TNFRSF10A (ARP30622_P050) antibody is Catalog # AAP30622
    Datasheets / Downloads:
    Printable datasheet for anti-TNFRSF10A (ARP30622_P050) antibody
    Ask a Question