website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

TNFRSF10A antibody - C-terminal region (ARP30622_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.
Gene Symbol:
TNFRSF10A
Official Gene Full Name:
Tumor necrosis factor receptor superfamily, member 10a
NCBI Gene Id:
8797
Alias Symbols:
APO2; CD261; DR4; MGC9365; TRAILR-1; TRAILR1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFRSF10A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF10A.
Swissprot Id:
O00220
Protein Accession #:
NP_003835
Nucleotide Accession #:
NM_003844
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Tumor necrosis factor receptor superfamily member 10A
Protein Size (# AA):
468
Molecular Weight:
50kDa
Application:
WB
Protein Interactions:
UBC; MARCH8; MARCH1; CFLAR; FADD; CUL3; TRAF2; CASP8; SQSTM1; TNFRSF10B; CBL; MOAP1; RASSF1; TNFRSF10D; TNFRSF10A; TNFSF10; MADD; BCL10; TRADD; RIPK1; DAP3; BTK; CD4; COL2A1; CASP10;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
TNFRSF10A antibody - C-terminal region (ARP30622_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 80%
Species Reactivity:
Human, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TNFRSF10A antibody
- ARP30622_P050
Peptide Sequence:
Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
Blocking Peptide:
For anti-TNFRSF10A antibody is Catalog # AAP30622
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question