website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TNFRSF10A antibody - C-terminal region (ARP30622_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.
Gene Symbol:
TNFRSF10A
Official Gene Full Name:
Tumor necrosis factor receptor superfamily, member 10a
NCBI Gene Id:
8797
Alias Symbols:
APO2; CD261; DR4; MGC9365; TRAILR-1; TRAILR1
Tissue Tool:
Find tissues and cell lines supported to express TNFRSF10A.
Protein Accession #:
NP_003835
Nucleotide Accession#:
NM_003844
Swissprot Id:
O00220
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Tumor necrosis factor receptor superfamily member 10A
Protein Size (# AA):
468
Molecular Weight:
50kDa
Application:
WB
Partner Proteins:
MOAP1,RASSF1,BCL10,BTK,CASP8,CD4,COL2A1,DAP3,FADD,MADD,MOAP1,RASSF1,RIPK1,TNFRSF10A,TNFRSF10B,TNFRSF10D,TNFSF10,TRADD,BCL10,CASP10,CASP8,CBL,CFLAR,DAP3,FADD,TNFSF10,TRADD,UBC
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TNFRSF10A antibody - C-terminal region (ARP30622_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 80%
Species Reactivity:
Human, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TNFRSF10A antibody
- ARP30622_P050
Peptide Sequence:
Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
Blocking Peptide:
For anti-TNFRSF10A antibody is Catalog # AAP30622
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TNFRSF10A antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for TNFRSF10A antibody (ARP30622)

Product page for TNFRSF10A antibody (ARP30622)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Human TNFRSF10A antibody; Homo sapiens TNFRSF10A antibody C1K3N4 100%
Human TNFRSF10A antibody; Homo sapiens TNFRSF10A antibody F8U8C0 93%
Human TR10A antibody; Homo sapiens TR10A antibody O00220 93%
Lowland gorilla TNFRSF10A antibody; Gorilla gorilla gorilla TNFRSF10A antibody G3QID0 100%
Northern white-cheeked gibbon TNFRSF10A antibody; Nomascus leucogenys TNFRSF10A antibody G1S189 93%
Rhesus macaque TNFRSF10A antibody; Macaca mulatta TNFRSF10A antibody F6TP00 80%
Rhesus macaque TNFRSF10A antibody; Macaca mulatta TNFRSF10A antibody F6Q522 80%
 
X
Ask a Question