website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TNFRSF10A antibody - C-terminal region (ARP30622_P050)

Receive a free positive control (AHL022) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.
Gene Symbol:
TNFRSF10A
Official Gene Full Name:
Tumor necrosis factor receptor superfamily, member 10a
NCBI Gene Id:
8797
Alias Symbols:
APO2; CD261; DR4; MGC9365; TRAILR-1; TRAILR1
Tissue Tool:
Find tissues and cell lines supported to express TNFRSF10A.
Protein Accession #:
NP_003835
Nucleotide Accession#:
NM_003844
Swissprot Id:
O00220
Host:
Rabbit
Protein Name:
Tumor necrosis factor receptor superfamily member 10A
Protein Size (# AA):
468
Molecular Weight:
50kDa
Application:
WB
Partner Proteins:
MOAP1,RASSF1,BCL10,BTK,CASP8,CD4,COL2A1,DAP3,FADD,MADD,MOAP1,RASSF1,RIPK1,TNFRSF10A,TNFRSF10B,TNFRSF10D,TNFSF10,TRADD,BCL10,CASP10,CASP8,CBL,CFLAR,DAP3,FADD,TNFSF10,TRADD,UBC
Product Format:
Lyophilized powder
Complete computational species homology data:
TNFRSF10A antibody - C-terminal region (ARP30622_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 80%
Species Reactivity:
Human, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-TNFRSF10A antibody
- ARP30622_P050
Peptide Sequence:
Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
Blocking Peptide:
For anti-TNFRSF10A antibody is Catalog # AAP30622
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TNFRSF10A antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question