website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TNFRSF10A antibody - C-terminal region (ARP30622_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Tumor necrosis factor receptor superfamily, member 10a
Protein Name:
Tumor necrosis factor receptor superfamily member 10A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
APO2, CD261, DR4, MGC9365, TRAILR-1, TRAILR1
Description of Target:
This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFRSF10A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFRSF10A.
Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 80%
Complete computational species homology data:
Anti-TNFRSF10A (ARP30622_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TNFRSF10A (ARP30622_P050) antibody is Catalog # AAP30622
Datasheets / Downloads:
Printable datasheet for anti-TNFRSF10A (ARP30622_P050) antibody
Ask a Question