website statistics

Aviva Systems Biology

Account Login 

Aviva Systems Biology office will be closed on Memorial Day - 5/27/2013.
Please go here for more info.

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

MXI1 antibody - middle region (ARP31403_P050)

Description of Target:
Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The MXI1 gene encodes a transcriptional repressor protein thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in MXI1 are frequently found in patients with prostate tumors.Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.
Gene Symbol:
MXI1
Official Gene Full Name:
MAX interactor 1
Alias Symbols:
MAD2; MGC43220; MXD2; MXI; bHLHc11
Tissue Tool:
Find tissues and cell lines supported to express MXI1.
Protein Accession# :
NP_569157
Nucleotide Accession#:
NM_130439
Swissprot Id:
P50539
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
295
Molecular Weight:
26kDa
Application:
WB, IHC
Partner Proteins:
CALM1, CALM3, CALM3, CSNK2A1, CSNK2A2, ID1, ID2, ID3, MDFI, MYF5, TCF3, ELSPBP1, ID1, ID2, ID3, MDFI, TCF3
Immunogen:
The immunogen for anti-MXI1 antibody: synthetic peptide directed towards the middle region of human MXI1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
MXI1 antibody - middle region (ARP31403_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 85%; Zebrafish: 78%
Datasheets / Downloads:
Printable datasheet for
anti-MXI1 antibody
- ARP31403_P050
Peptide Sequence:
Synthetic peptide located within the following region: LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Blocking Peptide:
For anti-MXI1 antibody is Catalog # AAP31403 (Previous Catalog # AAPS15701)
Key Reference:
Dugast-Darzacq,C., et al., (2004) Oncogene 23 (55), 8887-8899
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-MXI1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: MXI1 antibody tested with Human Fetal Brain Tissue (ARP31403_P050)

Aviva Systems Biology is the original manufacturer of this MXI1 antibody (ARP31403_P050)

Click here to view the MXI1 antibody Western Blot Protocol

Product Datasheet Link: MXI1 antibody (ARP31403_P050)

WB Suggested Anti-MXI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal brain

Western Blot image:


Description of Target: Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The MXI1 gene encodes a transcriptional repressor protein thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in MXI1 are frequently found in patients with prostate tumors.Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MXI1 antibody (ARP31403_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: MXI1 antibody tested by IHC with human lung (ARP31403)

Aviva Systems Biology is the original manufacturer of this MXI1 antibody.

Click here to view the MXI1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: MXI1 antibody (ARP31403)

IHC Information:

Rabbit Anti-MXI1 Antibody
Catalog Number: ARP31403
Paraffin Embedded Tissue: Human Lung
Cellular Data: Epithelial cells of bronchiole
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: