MORF4L2 antibody - N-terminal region (ARP33720_T100)

Catalog#: ARP33720_T100

• Size: 100ug

Human HepG2

Human kidney

• Description of Target: MORF4L2 is a member of the mortality factor (MORF) family of putative transcriptional regulators
• Gene Symbol: MORF4L2
• Official Gene Full Name: Mortality factor 4 like 2
• Alias Symbols: RP5-1055C14.2; KIAA0026; MORFL2; MRGX
• Protein Accession#: NP_036418
• Nucleotide Accession#: NM_012286
• Swissprot Id: Q15014
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 288
• Molecular Weight: 32kDa
• Application: WB, IHC
• Partner Proteins: C20orf20, CDR2, HDAC1, MRFAP1, RB1, SIN3A, TLE1, HDAC9, MPDU1, MRFAP1, PITPNA, RB1, SIN3A
• Immunogen: The immunogen for anti-MORF4L2 antibody: synthetic peptide directed towards the N terminal of human MORF4L2
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rat: 92%; Bovine: 84%
• Peptide Sequence: Synthetic peptide located within the following region: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN
• Blocking Peptide: For anti-MORF4L2 antibody is Catalog # AAP33720 (Previous Catalog # AAPS08006)
• Key Reference: Tominaga,K., (2003) J. Biol. Chem. 278 (49), 49618-49624
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-MORF4L2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: MORF4L2 antibody tested with Human Hepg2 Cells (ARP33720_T100)

Aviva Systems Biology is the original manufacturer of this MORF4L2 antibody (ARP33720_T100)

Click here to view the MORF4L2 antibody Western Blot Protocol

Product Datasheet Link: MORF4L2 antibody (ARP33720_T100)

WB Suggested Anti-MORF4L2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2

Western Blot image:


Description of Target: MORF4L2 is a member of the mortality factor (MORF) family of putative transcriptional regulators

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MORF4L2 antibody (ARP33720_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: MORF4L2 antibody tested by IHC with human kidney (ARP33720)

Aviva Systems Biology is the original manufacturer of this MORF4L2 antibody.

Click here to view the MORF4L2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: MORF4L2 antibody (ARP33720)

IHC Information:

Rabbit Anti-MORF4L2 Antibody
Catalog Number: ARP33720
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: