HES7 antibody - middle region (ARP30035_P050)

Catalog#: ARP30035_P050

• Size: 50ug

Human heart

Human kidney

Human Pancreas

• Description of Target: In mouse, Hes7 expression is associated with somitogenesis and is controlled by Notch signaling.
• Gene Symbol: HES7
• Official Gene Full Name: Hairy and enhancer of split 7 (Drosophila)
• Alias Symbols: SCDO4; bHLHb37
• Protein Accession#: NP_115969
• Nucleotide Accession#: NM_032580
• Swissprot Id: Q9BYE0
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 225
• Molecular Weight: 25kDa
• Application: WB, IHC
• Partner Proteins: CTNNB1
• Immunogen: The immunogen for anti-HES7 antibody: synthetic peptide directed towards the middle region of human HES7
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP
• Blocking Peptide: For anti-HES7 antibody is Catalog # AAP30035 (Previous Catalog # AAPH00211)
• Key Reference: Bessho,Y., et al., (2001) Cells 6 (2), 175-185
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-HES7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: HES7 antibody tested with Human Heart Tissue (ARP30035_P050)

Aviva Systems Biology is the original manufacturer of this HES7 antibody (ARP30035_P050)

Click here to view the HES7 antibody Western Blot Protocol

Product Datasheet Link: HES7 antibody (ARP30035_P050)

WB Suggested Anti-HES7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Heart

Western Blot image:


Description of Target: In mouse, Hes7 expression is associated with somitogenesis and is controlled by Notch signaling.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s HES7 antibody (ARP30035_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: HES7 antibody tested by IHC with human pancreas (ARP30035)

Aviva Systems Biology is the original manufacturer of this HES7 antibody.

Click here to view the HES7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: HES7 antibody (ARP30035)

IHC Information:

Rabbit Anti-HES7 Antibody
Catalog Number: ARP30035
Paraffin Embedded Tissue: Human Pancreas
Cellular Data: Epithelial cells of pancreatic acinus
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: HES7 antibody tested by IHC with human kidney (ARP30035)

Aviva Systems Biology is the original manufacturer of this HES7 antibody.

Click here to view the HES7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: HES7 antibody (ARP30035)

IHC Information:

Rabbit Anti-HES7 Antibody
Catalog Number: ARP30035
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: