website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

GFI1B antibody - N-terminal region (ARP30093_P050)

Description of Target:
GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.
Gene Symbol:
GFI1B
Official Gene Full Name:
Growth factor independent 1B transcription repressor
Tissue Tool:
Find tissues and cell lines supported to express GFI1B.
Protein Accession# :
NP_004179
Nucleotide Accession#:
NM_004188
Swissprot Id:
Q6T888
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
330
Molecular Weight:
38kDa
Application:
WB, IHC
Immunogen:
The immunogen for anti-GFI1B antibody: synthetic peptide directed towards the N terminal of human GFI1B
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
GFI1B antibody - N-terminal region (ARP30093_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Bovine: 83%; Mouse: 83%; Rat: 75%
Datasheets / Downloads:
Printable datasheet for
anti-GFI1B antibody
- ARP30093_P050
Peptide Sequence:
Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Blocking Peptide:
For anti-GFI1B antibody is Catalog # AAP30093 (Previous Catalog # AAPH00269)
Key Reference:
Huang,D.Y., et al., (2004) Nucleic Acids Res. 32 (13), 3935-3946
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-GFI1B antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: GFI1B antibody tested with Human Jurkat Cells (ARP30093_P050)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody (ARP30093_P050)

Click here to view the GFI1B antibody Western Blot Protocol

Product Datasheet Link: GFI1B antibody (ARP30093_P050)

WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:


Description of Target: GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GFI1B antibody (ARP30093_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: GFI1B antibody tested by IHC with human kidney (ARP30093)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody.

Click here to view the GFI1B antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GFI1B antibody (ARP30093)

IHC Information:

Rabbit Anti-GFI1B Antibody
Catalog Number: ARP30093
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule and renal corpuscle
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: GFI1B antibody tested by IHC with human heart (ARP30093)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody.

Click here to view the GFI1B antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GFI1B antibody (ARP30093)

IHC Information:

Rabbit Anti-GFI1B Antibody
Catalog Number: ARP30093
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: