website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

FOSL2 antibody - middle region (ARP31277_P050)

Description of Target:
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2, which encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Gene Symbol:
FOSL2
Official Gene Full Name:
FOS-like antigen 2
Alias Symbols:
FRA2
Tissue Tool:
Find tissues and cell lines supported to express FOSL2.
Protein Accession# :
NP_005244
Nucleotide Accession#:
NM_005253
Swissprot Id:
P15408
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
326
Molecular Weight:
35kDa
Application:
WB, IHC
Partner Proteins:
CSNK2A1, CSNK2B, CTDP1, DR1, DRAP1, ERCC3, GTF2F1, MED23, POLR2D, POLR2D, SUB1, TBP, E6, EP300, HMGA1, IRF8, KAT2B, NFKB1, RELA, STAT1, HMGA1, IRF8, KAT2A, KAT2B, STAT1, UBC
Immunogen:
The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
FOSL2 antibody - middle region (ARP31277_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 91%; Rat: 91%; Zebrafish: 90%; Chicken: 83%
Datasheets / Downloads:
Printable datasheet for
anti-FOSL2 antibody
- ARP31277_P050
Peptide Sequence:
Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY
Blocking Peptide:
For anti-FOSL2 antibody is Catalog # AAP31277 (Previous Catalog # AAPP02026)
Key Reference:
Molven,A., et al., (1996) Genomics 38(1),72-75
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-FOSL2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: FOSL2 antibody tested with Human Jurkat Cells (ARP31277_P050)

Aviva Systems Biology is the original manufacturer of this FOSL2 antibody (ARP31277_P050)

Click here to view the FOSL2 antibody Western Blot Protocol

Product Datasheet Link: FOSL2 antibody (ARP31277_P050)

WB Suggested Anti-FOSL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:


Description of Target: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2, which encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s FOSL2 antibody (ARP31277_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: FOSL2 antibody tested by IHC with human intestine (ARP31277)

Aviva Systems Biology is the original manufacturer of this FOSL2 antibody.

Click here to view the FOSL2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: FOSL2 antibody (ARP31277)

IHC Information:

Rabbit Anti-FOSL2 Antibody
Catalog Number: ARP31277
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal glands
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: FOSL2 antibody tested by IHC with human liver (ARP31277)

Aviva Systems Biology is the original manufacturer of this FOSL2 antibody.

Click here to view the FOSL2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: FOSL2 antibody (ARP31277)

IHC Information:

Rabbit Anti-FOSL2 Antibody
Catalog Number: ARP31277
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocyte
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Review: FOSL2 antibody-middle region (ARP31277_P050) in zebrafish FoSL2 protein using Western blot

Product Page for FOSL2 antibody-middle region (ARP31277_P050)

Researcher:Leila Jahangiri. Massachusetts General Hospital, Harvard Medical School
Application:Western blotting
Species+tissue/cell type:Lane 1: 15ul purified zebrafish FoSL2 protein Lane 2: 10ul purified zebrafish FoSL2 protein
Primary antibody dilution:1:500
Secondary antibody:Goat anti-rabbit HRP
Secondary antibody dilution:1:5000

Questionnaire:
How do Aviva’s reagents play a role in your experimental goals? I have been conducting experiments on fosl2 gene in zebrafish. I have been using Aviva antibody for western blots.
How would you rate this antibody on a scale from 1-5 (5=best) and why? This antibody recognises recombinant Fosl2 protein and in vitro synthesised Fosl2 protein. It can also recognise the endogenous Fosl2 from protein slurry. 4/5
Would you use this antibody in future experiments? I would used this antibody for WB against Fosl2
Have you used another antibody which has worked in your application? Yes I have also generated a zebrafish specific Fosl2 antibody.
Do you believe the information about the reagent on Aviva’s website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes- this antibody reliably recognises Fosl2 in western blots
How did you store the antibody after re-suspension? Yes- this antibody reliably recognises Fosl2 in western blots
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Zebrafish, whole embryo.
How many different experimental trials were conducted using the antibody sample?  3-4
How was this sample prepared? I have used between 5-10ul of recombinant zebrafish Fosl2 protein, or 20ul of whole embryo slurry.
Primary antibody dilution and incubation time:  1:500, incubated at room temperature for 1 hour.
Secondary antibody used and dilution and incubation time: Goat anti rabbit polyclonal HRP conjugated.
What controls were used in your experiment (positive/negative)? Recombinant Fosl2 served as a positive control
Please include your detailed WB Procedure/Protocol here: Dechorionating & deyolking1. Remove embryos from their chorions in batches of ~100 by placing in 1 mg/ml of pronaseand swirling occasionally (5-10 minutes for 24 hpf embryos, 10-20 minutes for 3 day embryos). Finish dechorionation by gentle trituration using a Pasteur pipette. The chorions float and can be decanted. Rinse three times in cold Ringer's solution.
2.Transfer the embryos to cold Ringer's with EDTA and PMSF. Remove yolks by triturating with a glass pipette that has been drawn out to have a tip diameter approximately the size of the yolk.
3.Transfer the dechorionated, deyolked embryos to fresh, cold Ringer's solution and rinse twice.
4.Embryos can be frozen in liquid nitrogen and stored at 70 d C at this point by transferring to a microcentifuge tube and removing as much liquid as possible.
Solutions:
Pronase:
5 mg/ml pronasediluted to 1 mg/ml in Embryo Medium
PMSF:
Stock - 100 mM phenylmethylsulfonylfluoride in Isopropanol. Immediately before use, add 30 ul of stock/10 ml Ringer's (final conc. 0.3 mM PMSF).
EDTA:
Stock - 10 mM EDTA, pH 7.0. Add 1 ml of stock/10 ml Ringer's (final conc. 1mM EDTA)
Preparation of gel sample
1. Remove from freezer and thaw the frozen, dechorionated, deyolked fish.
2. Microfuge for 1-2 minutes to pellet.
3. Remove excess liquid.
4. Add 150-200 ul SDS sample buffer (for example, ~50-100 3 day embryos or 100-150 24 hpf embryos; this will yield enough for a 1.5 cm curtain or four 0.4 cm lanes of about 25-30 ul each).
5. Homogenize with microfuge pestle until uniform in consistency.
6. Repeat step 5 until sample is no longer stringy.
7. Boil 5 minutes in a water bath.
8. Microfuge, 1-2 minutes.
9. Transfer supernatant to a new microfuge tube. Discard pellet or add more sample buffer and homogenize again if significant pellet remains.