- Description of Target:
- UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
- Gene Symbol:
- UNC5A
- Official Gene Full Name:
- Unc-5 homolog A (C. elegans)
- Alias Symbols:
- FLJ16449; KIAA1976; UNC5H1
- Tissue Tool:
- Find tissues and cell lines supported to express UNC5A.
- Protein Accession# :
- NP_588610
- Nucleotide Accession#:
- NM_133369
- Swissprot Id:
- Q6ZN44
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 842
- Molecular Weight:
- 93kDa
- Application:
- WB
- Partner Proteins:
- EMID1, EMID2
- Immunogen:
- The immunogen for anti-UNC5A antibody: synthetic peptide directed towards the middle region of human UNC5A
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- UNC5A antibody - middle region (ARP50294_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%; Chicken: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-UNC5A antibody
- ARP50294_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
- Blocking Peptide:
- For anti-UNC5A antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371)
- Key Reference:
- Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-UNC5A antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: UNC5A antibody tested with Human Hela Cells (ARP50294_P050)
Aviva Systems Biology is the original manufacturer of this UNC5A antibody (ARP50294_P050)
Click here to view the UNC5A antibody Western Blot Protocol
Product Datasheet Link: UNC5A antibody (ARP50294_P050)
WB Suggested Anti-UNC5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela
Western Blot image: 
Description of Target: UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s UNC5A antibody (ARP50294_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
