website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

SEMA4F antibody - N-terminal region (ARP46421_P050)

Description of Target:
SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Gene Symbol:
SEMA4F
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Alias Symbols:
SEMAM; SEMAW; M-SEMA; PRO2353; m-Sema-M
Tissue Tool:
Find tissues and cell lines supported to express SEMA4F.
Protein Accession# :
AAH18361
Nucleotide Accession#:
NM_004263
Swissprot Id:
O95754-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
615
Molecular Weight:
67kDa
Application:
WB
Immunogen:
The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SEMA4F antibody - N-terminal region (ARP46421_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Dog: 92%
Datasheets / Downloads:
Printable datasheet for
anti-SEMA4F antibody
- ARP46421_P050
Peptide Sequence:
Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Blocking Peptide:
For anti-SEMA4F antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-SEMA4F antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: SEMA4F antibody tested with Human Transfected 293T Cells (ARP46421_P050)

Aviva Systems Biology is the original manufacturer of this SEMA4F antibody (ARP46421_P050)

Click here to view the SEMA4F antibody Western Blot Protocol

Product Datasheet Link: SEMA4F antibody (ARP46421_P050)

WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SEMA4F antibody (ARP46421_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in human cell line A431 using Western Blot

Product Page for SEMA4F antibody N-terminal region(ARP46421_P050)

Data Provided by Tianliang Sun, Max Planck Institute for Heart and Lung Research

Sample Description:

human cell line A431, load ab 500,000 cells per lane

How many different experimental trials were conducted using the antibody sample?

three

How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB.

6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:1:600, 4 degree overnight

Secondary antibody used and dilution and incubation time: 1:3000, RT 2 hours

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown

WB Procedure/Protocol:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT

Incubate with antibody diluted in block buffer at 4 degree overnight

Wash 3 time with TBST , 15min each

2nd antibody dilute in block buffer at RT for 2 hours

Wash 3 times with TBST; 15 min each

Develop with ECL in dark room.

Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in human pancreatic carcinoma cell line MIA PaCa-2 cells using Western Blot

Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Application: Western blotting
Species+tissue/cell type: MIA-PACA2 cells
How many ug’s of tissue/cell lysate run on the gel:
1. Untransfected MIA-PACA2 cell lysate
2. Untransfected MIA-PACA2 cell lysate
3. Untransfected MIA-PACA2 cell lysate
4. hSEMA4F transfected MIA-PACA2 cell lysate
5. Untransfected MIA-PACA2 cell lysate
6. hSEMA4F transfected MIA-PACA2 cell lysate
Primary antibody dilution: 1:600
Secondary antibody: Donkey Anti-rabbit HRP
Secondary antibody dilution: 1:3000

Questionnaire:

How do Aviva’s reagents play a role in your experimental goals?

React with overexpression system and native (not sure).

How would you rate this antibody on a scale from 1-5 (5=best) and why?

4.

Would you use this antibody in future experiments?

WB for overexpression system and WB for cell express high level of sema4F.

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes, if it works.

How did you store the antibody after re-suspension?

4 degree

How many different experimental trials were conducted using the antibody sample?

Three.

How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:

1:600, 4 degree overnight.

Secondary antibody used and dilution and incubation time:

1:3000, RT 2 hours

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown.

Please include your detailed WB Procedure/Protocol here:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT.

Incubate with antibody diluted in block buffer at 4 degree overnight.

Wash 3 time with TBST , 15min each.

2nd antibody dilute in block buffer at RT for 2 hours.

Wash 3 times with TBST; 15 min each.

Develop with ECL in dark room.

Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in A431 cells using Western Blot

Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Application: Western blotting
Species+tissue/cell type: A431 cells
How many ug’s of tissue/cell lysate run on the gel:
1. A431 cell lysate + control siRNA
2. A431 cell lysate + SEMA4F siRNA
Primary antibody dilution: 1:600
Secondary antibody: Donkey Anti-rabbit HRP
Secondary antibody dilution: 1:3000

Questionnaire:

How do Aviva’s reagents play a role in your experimental goals?

React with overexpression system and native (not sure).

How would you rate this antibody on a scale from 1-5 (5=best) and why?

4.

Would you use this antibody in future experiments?

WB for overexpression system and WB for cell express high level of sema4F.

Have you used another antibody which has worked in your application?

yes

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes.

How did you store the antibody after re-suspension?

4 degree C.

Western Blot Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):

Human cell lines A431, load ab 500,000 cells per lane.

How many different experimental trials were conducted using the antibody sample?

Three.

How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:

1:600, 4 degree overnight.

Secondary antibody used and dilution and incubation time:

1:3000, RT 2 hours.

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown.

Please include your detailed WB Procedure/Protocol here:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours.

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT.

Incubate with antibody diluted in block buffer at 4 degree overnight.

Wash 3 time with TBST , 15min each.

2nd antibody dilute in block buffer at RT for 2 hours.

Wash 3 times with TBST; 15 min each.

Develop with ECL in dark room.