website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SEMA4F antibody - N-terminal region (ARP46421_P050)

Description of Target:
SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Gene Symbol:
SEMA4F
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
NCBI Gene Id:
10505
Alias Symbols:
SEMAM; SEMAW; M-SEMA; PRO2353; m-Sema-M
Tissue Tool:
Find tissues and cell lines supported to express SEMA4F.
Protein Accession #:
AAH18361
Nucleotide Accession#:
NM_004263
Swissprot Id:
O95754-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Semaphorin-4F
Protein Size (# AA):
615
Molecular Weight:
67kDa
Application:
WB
Immunogen:
The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SEMA4F antibody - N-terminal region (ARP46421_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%
Species Reactivity:
Bovine, Human, Mouse, Pig, Horse, Rabbit, Rat, Guinea pig, Dog
Datasheets / Downloads:
Printable datasheet for
anti-SEMA4F antibody
- ARP46421_P050
Peptide Sequence:
Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Blocking Peptide:
For anti-SEMA4F antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SEMA4F antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for SEMA4F antibody (ARP46421)

Product page for SEMA4F antibody (ARP46421)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant SEMA4F antibody; Loxodonta africana SEMA4F antibody G3U609 100%
African elephant SEMA4F antibody; Loxodonta africana SEMA4F antibody G3U1U9 100%
Bovine SEMA4F antibody; Bos taurus SEMA4F antibody E1BF41 100%
Bovine SEMA4F antibody; Bos taurus SEMA4F antibody A6QQH8 100%
Dog SEMA4F antibody; Canis familiaris SEMA4F antibody E2R4N1 92%
Giant panda SEMA4F antibody; Ailuropoda melanoleuca SEMA4F antibody D2HH51 92%
Gray short-tailed opossum SEMA4F antibody; Monodelphis domestica SEMA4F antibody F6U6J1 85%
Guinea pig SEMA4F antibody; Cavia porcellus SEMA4F antibody H0V6H4 100%
Horse SEMA4F antibody; Equus caballus SEMA4F antibody F6PUR8 100%
Human SEM4F antibody; Homo sapiens SEM4F antibody O95754 100%
Human SEM4F antibody; Homo sapiens SEM4F antibody O95754-2 100%
Human SEMA4F antibody; Homo sapiens SEMA4F antibody C9JKW7 100%
Lowland gorilla SEMA4F antibody; Gorilla gorilla gorilla SEMA4F antibody G3RBD9 100%
Mouse SEM4F antibody; Mus musculus SEM4F antibody Q9Z123 100%
Mouse Sema4f antibody; Mus musculus Sema4f antibody Q810B2 100%
Mouse Sema4f antibody; Mus musculus Sema4f antibody D3YWP2 100%
Northern white-cheeked gibbon SEMA4F antibody; Nomascus leucogenys SEMA4F antibody G1QJY9 100%
Pig SEMA4F antibody; Sus scrofa SEMA4F antibody F1SNW1 100%
Rabbit SEMA4F antibody; Oryctolagus cuniculus SEMA4F antibody G1SMA2 100%
Rat SEM4F antibody; Rattus norvegicus SEM4F antibody Q9Z143 100%
Rhesus macaque SEMA4F antibody; Macaca mulatta SEMA4F antibody F7DBA4 100%
Small-eared galago SEMA4F antibody; Otolemur garnettii SEMA4F antibody H0XP26 100%
Tasmanian devil SEMA4F antibody; Sarcophilus harrisii SEMA4F antibody G3WVI1 85%
White-tufted-ear marmoset SEMA4F antibody; Callithrix jacchus SEMA4F antibody F7IA44 100%
White-tufted-ear marmoset SEMA4F antibody; Callithrix jacchus SEMA4F antibody F7I7S7 100%
White-tufted-ear marmoset SEMA4F antibody; Callithrix jacchus SEMA4F antibody F7I7T5 100%

Product Protocols: SEMA4F antibody tested with Human Transfected 293T Cells (ARP46421_P050)

Aviva Systems Biology is the original manufacturer of this SEMA4F antibody (ARP46421_P050)

Click here to view the SEMA4F antibody Western Blot Protocol

Product Datasheet Link: SEMA4F antibody (ARP46421_P050)

WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Western Blot image:


Description of Target: SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SEMA4F antibody (ARP46421_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in human cell line A431 using Western Blot

Product Page for SEMA4F antibody N-terminal region(ARP46421_P050)

Data Provided by Tianliang Sun, Max Planck Institute for Heart and Lung Research

Sample Description:

human cell line A431, load ab 500,000 cells per lane

How many different experimental trials were conducted using the antibody sample?

three

How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB.

6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:1:600, 4 degree overnight

Secondary antibody used and dilution and incubation time: 1:3000, RT 2 hours

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown

WB Procedure/Protocol:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT

Incubate with antibody diluted in block buffer at 4 degree overnight

Wash 3 time with TBST , 15min each

2nd antibody dilute in block buffer at RT for 2 hours

Wash 3 times with TBST; 15 min each

Develop with ECL in dark room.

Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in human pancreatic carcinoma cell line MIA PaCa-2 cells using Western Blot

Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Application: Western blotting
Species+tissue/cell type: MIA-PACA2 cells
How many ug’s of tissue/cell lysate run on the gel:
1. Untransfected MIA-PACA2 cell lysate
2. Untransfected MIA-PACA2 cell lysate
3. Untransfected MIA-PACA2 cell lysate
4. hSEMA4F transfected MIA-PACA2 cell lysate
5. Untransfected MIA-PACA2 cell lysate
6. hSEMA4F transfected MIA-PACA2 cell lysate
Primary antibody dilution: 1:600
Secondary antibody: Donkey Anti-rabbit HRP
Secondary antibody dilution: 1:3000

Questionnaire:

How do Aviva’s reagents play a role in your experimental goals?

React with overexpression system and native (not sure).

How would you rate this antibody on a scale from 1-5 (5=best) and why?

4.

Would you use this antibody in future experiments?

WB for overexpression system and WB for cell express high level of sema4F.

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes, if it works.

How did you store the antibody after re-suspension?

4 degree

How many different experimental trials were conducted using the antibody sample?

Three.

How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:

1:600, 4 degree overnight.

Secondary antibody used and dilution and incubation time:

1:3000, RT 2 hours

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown.

Please include your detailed WB Procedure/Protocol here:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT.

Incubate with antibody diluted in block buffer at 4 degree overnight.

Wash 3 time with TBST , 15min each.

2nd antibody dilute in block buffer at RT for 2 hours.

Wash 3 times with TBST; 15 min each.

Develop with ECL in dark room.

Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in A431 cells using Western Blot

Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Application: Western blotting
Species+tissue/cell type: A431 cells
How many ug’s of tissue/cell lysate run on the gel:
1. A431 cell lysate + control siRNA
2. A431 cell lysate + SEMA4F siRNA
Primary antibody dilution: 1:600
Secondary antibody: Donkey Anti-rabbit HRP
Secondary antibody dilution: 1:3000

Questionnaire:

How do Aviva’s reagents play a role in your experimental goals?

React with overexpression system and native (not sure).

How would you rate this antibody on a scale from 1-5 (5=best) and why?

4.

Would you use this antibody in future experiments?

WB for overexpression system and WB for cell express high level of sema4F.

Have you used another antibody which has worked in your application?

yes

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes.

How did you store the antibody after re-suspension?

4 degree C.

Western Blot Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):

Human cell lines A431, load ab 500,000 cells per lane.

How many different experimental trials were conducted using the antibody sample?

Three.

How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:

1:600, 4 degree overnight.

Secondary antibody used and dilution and incubation time:

1:3000, RT 2 hours.

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown.

Please include your detailed WB Procedure/Protocol here:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours.

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT.

Incubate with antibody diluted in block buffer at 4 degree overnight.

Wash 3 time with TBST , 15min each.

2nd antibody dilute in block buffer at RT for 2 hours.

Wash 3 times with TBST; 15 min each.

Develop with ECL in dark room.

 
X
Ask a Question