website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

SEMA4F antibody - N-terminal region (ARP46421_P050)

Description of Target:
SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Gene Symbol:
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express SEMA4F.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
SEMA4F antibody - N-terminal region (ARP46421_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%
Species Reactivity:
Bovine, Human, Mouse, Pig, Horse, Rabbit, Rat, Guinea pig, Dog
Datasheets / Downloads:
Printable datasheet for
anti-SEMA4F antibody
- ARP46421_P050
Peptide Sequence:
Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Blocking Peptide:
For anti-SEMA4F antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SEMA4F antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question