website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/4/2016.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SEMA4F antibody - N-terminal region (ARP46421_P050)

  • Catalog#: ARP46421_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
    Protein Name:
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
    Description of Target:
    SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express SEMA4F.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express SEMA4F.
    The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-SEMA4F (ARP46421_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    DLG4; NRP2;
    Blocking Peptide:
    For anti-SEMA4F (ARP46421_P050) antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
    Datasheets / Downloads:
    Printable datasheet for anti-SEMA4F (ARP46421_P050) antibody

    Product Protocols: SEMA4F antibody tested with Human Transfected 293T Cells (ARP46421_P050)

    Aviva Systems Biology is the original manufacturer of this SEMA4F antibody (ARP46421_P050)

    Click here to view the SEMA4F antibody Western Blot Protocol

    Product Datasheet Link: SEMA4F antibody (ARP46421_P050)

    WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Transfected 293T

    Western Blot image:

    Description of Target: SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s SEMA4F antibody (ARP46421_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in human cell line A431 using Western Blot

    Product Page for SEMA4F antibody N-terminal region(ARP46421_P050)

    Data Provided by Tianliang Sun, Max Planck Institute for Heart and Lung Research

    Sample Description:

    human cell line A431, load ab 500,000 cells per lane

    How many different experimental trials were conducted using the antibody sample?


    How was this sample prepared?

    Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB.

    6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

    Primary antibody dilution and incubation time:1:600, 4 degree overnight

    Secondary antibody used and dilution and incubation time: 1:3000, RT 2 hours

    What controls were used in your experiment (positive/negative)?

    Control siRNA knockdown

    WB Procedure/Protocol:

    Samples are load on 8% SDS PAGE gel, 40ul per well.

    150v for 1.5 hours

    Transfer the gel to membrane (10%methal) at 400mA ,2hours.

    Block with 5% milk in TBST 1hour at RT

    Incubate with antibody diluted in block buffer at 4 degree overnight

    Wash 3 time with TBST , 15min each

    2nd antibody dilute in block buffer at RT for 2 hours

    Wash 3 times with TBST; 15 min each

    Develop with ECL in dark room.

    Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in human pancreatic carcinoma cell line MIA PaCa-2 cells using Western Blot

    Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

    Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
    Application: Western blotting
    Species+tissue/cell type: MIA-PACA2 cells
    How many ug’s of tissue/cell lysate run on the gel:
    1. Untransfected MIA-PACA2 cell lysate
    2. Untransfected MIA-PACA2 cell lysate
    3. Untransfected MIA-PACA2 cell lysate
    4. hSEMA4F transfected MIA-PACA2 cell lysate
    5. Untransfected MIA-PACA2 cell lysate
    6. hSEMA4F transfected MIA-PACA2 cell lysate
    Primary antibody dilution: 1:600
    Secondary antibody: Donkey Anti-rabbit HRP
    Secondary antibody dilution: 1:3000


    How do Aviva’s reagents play a role in your experimental goals?

    React with overexpression system and native (not sure).

    How would you rate this antibody on a scale from 1-5 (5=best) and why?


    Would you use this antibody in future experiments?

    WB for overexpression system and WB for cell express high level of sema4F.

    If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

    Yes, if it works.

    How did you store the antibody after re-suspension?

    4 degree

    How many different experimental trials were conducted using the antibody sample?


    How was this sample prepared?

    Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

    Primary antibody dilution and incubation time:

    1:600, 4 degree overnight.

    Secondary antibody used and dilution and incubation time:

    1:3000, RT 2 hours

    What controls were used in your experiment (positive/negative)?

    Control siRNA knockdown.

    Please include your detailed WB Procedure/Protocol here:

    Samples are load on 8% SDS PAGE gel, 40ul per well.

    150v for 1.5 hours

    Transfer the gel to membrane (10%methal) at 400mA ,2hours.

    Block with 5% milk in TBST 1hour at RT.

    Incubate with antibody diluted in block buffer at 4 degree overnight.

    Wash 3 time with TBST , 15min each.

    2nd antibody dilute in block buffer at RT for 2 hours.

    Wash 3 times with TBST; 15 min each.

    Develop with ECL in dark room.

    Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in A431 cells using Western Blot

    Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

    Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
    Application: Western blotting
    Species+tissue/cell type: A431 cells
    How many ug’s of tissue/cell lysate run on the gel:
    1. A431 cell lysate + control siRNA
    2. A431 cell lysate + SEMA4F siRNA
    Primary antibody dilution: 1:600
    Secondary antibody: Donkey Anti-rabbit HRP
    Secondary antibody dilution: 1:3000


    How do Aviva’s reagents play a role in your experimental goals?

    React with overexpression system and native (not sure).

    How would you rate this antibody on a scale from 1-5 (5=best) and why?


    Would you use this antibody in future experiments?

    WB for overexpression system and WB for cell express high level of sema4F.

    Have you used another antibody which has worked in your application?


    If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?


    How did you store the antibody after re-suspension?

    4 degree C.

    Western Blot Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):

    Human cell lines A431, load ab 500,000 cells per lane.

    How many different experimental trials were conducted using the antibody sample?


    How was this sample prepared?

    Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

    Primary antibody dilution and incubation time:

    1:600, 4 degree overnight.

    Secondary antibody used and dilution and incubation time:

    1:3000, RT 2 hours.

    What controls were used in your experiment (positive/negative)?

    Control siRNA knockdown.

    Please include your detailed WB Procedure/Protocol here:

    Samples are load on 8% SDS PAGE gel, 40ul per well.

    150v for 1.5 hours.

    Transfer the gel to membrane (10%methal) at 400mA ,2hours.

    Block with 5% milk in TBST 1hour at RT.

    Incubate with antibody diluted in block buffer at 4 degree overnight.

    Wash 3 time with TBST , 15min each.

    2nd antibody dilute in block buffer at RT for 2 hours.

    Wash 3 times with TBST; 15 min each.

    Develop with ECL in dark room.

    Ask a Question