RHOD antibody - C-terminal region (ARP42414_P050)

Catalog#: ARP42414_P050

• Size: 50ug

Transfected 293T

Human Tonsil

• Description of Target: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Gene Symbol: RHOD
• Official Gene Full Name: Ras homolog family member D
• Alias Symbols: ARHD; RHOHP1; RHOM; Rho
• Protein Accession#: NP_055393
• Nucleotide Accession#: NM_014578
• Swissprot Id: O00212
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 210
• Molecular Weight: 23kDa
• Application: WB
• Partner Proteins: GRB2, RALA, GRB2, NCK1, RALA
• Immunogen: The immunogen for anti-RHOD antibody: synthetic peptide directed towards the C terminal of human RHOD
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 81%; Rat: 81%
• Peptide Sequence: Synthetic peptide located within the following region: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG
• Blocking Peptide: For anti-RHOD antibody is Catalog # AAP42414 (Previous Catalog # AAPP24760)
• Key Reference: Tong,Y., (2007) J. Biol. Chem. 282 (51), 37215-37224
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-RHOD antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: RHOD antibody tested with Human Transfected 293T Cells (ARP42414_P050)

Aviva Systems Biology is the original manufacturer of this RHOD antibody (ARP42414_P050)

Click here to view the RHOD antibody Western Blot Protocol

Product Datasheet Link: RHOD antibody (ARP42414_P050)

WB Suggested Anti-RHOD Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Western Blot image:


Description of Target: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RHOD antibody (ARP42414_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com