- Description of Target:
- Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
- Gene Symbol:
- TRAP1
- Alias Symbols:
- HSP75; HSP90L
- Tissue Tool:
- Find tissues and cell lines supported to express TRAP1.
- Protein Accession# :
- NP_057376
- Nucleotide Accession#:
- NM_016292
- Swissprot Id:
- Q12931
- Host:
- Rabbit
- Protein Size (# AA):
- 704
- Molecular Weight:
- 80kDa
- Application:
- WB
- Partner Proteins:
- EXT1,EXT2,RB1,SMAD4,TGFBR1,TGFBR2,TLR1,TLR6,TNFRSF1A,AI837181,EXT1,EXT2,H2AFX,HDAC5,HGS,RAD21,RB1,RYK,SF3A2,SUMO2,TNFRSF1A,UBC
- Immunogen:
- The immunogen for Anti-TRAP1 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAP1
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- TRAP1 Antibody - N-terminal region (ARP30183_P050)
- Datasheets / Downloads:
- Printable datasheet for
anti-TRAP1 antibody
ARP30183_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
- Blocking Peptide:
- Catalog # AAP30183
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final Anti-TRAP1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
