TNFSF14 Antibody - middle region (AVARP02041_P050)

Catalog No: AVARP02041_P050

WB Suggested Anti-TNFSF14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateTNFSF14 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNFSF14
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TNFSF14 (AVARP02041_P050) antibody is Catalog # AAP30631 (Previous Catalog # AAPP01284)
• Sample Type Confirmation:

  TNFSF14 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Kong,M., (er) J. Biomed. Sci. (2008) In press

Target Info

• Gene Symbol: TNFSF14
• Gene Full Name: Tumor necrosis factor (ligand) superfamily, member 14
• Alias Symbols: LTg, CD258, HVEML, LIGHT
• NCBI Gene Id: 8740
• Protein Name: Tumor necrosis factor ligand superfamily member 14
• Description of Target: TNFSF14 is the cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B TNFSF14 modulates its effects. TNFSF14 activates NFKB, stimulates the proliferation of T-cells, and inhibits growth of the adenocarcinoma HT-29. TNFSF14 acts as a receptor for Herpes simplex virus.The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.
• Uniprot ID: O43557
• Protein Accession #: NP_003798
• Nucleotide Accession #: NM_003807
• Protein Size (# AA): 240
• Molecular Weight: 22kDa
• Protein Interactions: APP; TNFRSF6B; TNFRSF14; LTBR; LTB; DIABLO; TRAF3; TRAF2; BIRC2;