SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41273_P050
Price: $0.00
SKU
ARP41273_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Rhou (ARP41273_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 100%; Rat: 79%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: GRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFS
Concentration0.5 mg/ml
Blocking PeptideFor anti-Rhou (ARP41273_P050) antibody is Catalog # AAP41273
Gene SymbolRhou
Gene Full NameRas homolog gene family, member U
Alias SymbolsAr, Arhu, G28K, WRCH, WRCH-, WRCH1, mG28K, CDC42L, WRCH-1, CDC42L1, AI182090, 2310026M05Rik
NCBI Gene Id69581
Protein NameRho-related GTP-binding protein RhoU
Description of TargetRhou acts upstream of PAK1 to regulate the actin cytoskeleton, adhesion turnover and increase cell migration. Rhou stimulates quiescent cells to reenter the cell cycle. Rhou has no detectable GTPase activity but its high intrinsic guanine nucleotide exchange activity suggests it is constitutively GTP-bound.
Uniprot IDQ9EQT3
Protein Accession #NP_598716
Nucleotide Accession #NM_133955
Protein Size (# AA)261
Molecular Weight28kDa
  1. What is the species homology for "Rhou Antibody - N-terminal region (ARP41273_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "Rhou Antibody - N-terminal region (ARP41273_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Rhou Antibody - N-terminal region (ARP41273_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Rhou Antibody - N-terminal region (ARP41273_P050)"?

    This target may also be called "Ar, Arhu, G28K, WRCH, WRCH-, WRCH1, mG28K, CDC42L, WRCH-1, CDC42L1, AI182090, 2310026M05Rik" in publications.

  5. What is the shipping cost for "Rhou Antibody - N-terminal region (ARP41273_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Rhou Antibody - N-terminal region (ARP41273_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Rhou Antibody - N-terminal region (ARP41273_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Rhou Antibody - N-terminal region (ARP41273_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RHOU"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RHOU"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RHOU"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RHOU"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RHOU"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RHOU"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Rhou Antibody - N-terminal region (ARP41273_P050)
Your Rating
We found other products you might like!