PLSCR2 Antibody - C-terminal region (ARP66433_P050)

Catalog No: ARP66433_P050

WB Suggested Anti-PLSCR2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLSCR2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 75%; Rabbit: 79%; Rat: 75%
• Peptide Sequence: Synthetic peptide located within the following region: PVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PLSCR2 (ARP66433_P050) antibody is Catalog # AAP66433

Target Info

• Gene Symbol: PLSCR2
• Alias Symbols: -
• NCBI Gene Id: 57047
• Protein Name: Phospholipid scramblase 2
• Description of Target: This gene encodes a member of the phospholipid scramblase family. Phospholipid scramblases are membrane proteins that mediate calcium-dependent, non-specific movement of plasma membrane phospholipids and phosphatidylserine exposure. The encoded protein contains a low affinity calcium binding motif and may play a role in blood coagulation and apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Uniprot ID: Q9NRY7
• Protein Accession #: NP_065092
• Nucleotide Accession #: NM_020359
• Protein Size (# AA): 224
• Molecular Weight: 25kDa
• Protein Interactions: EP300;