Pdgfc Antibody - N-terminal region (ARP61794_P050)

Catalog No: ARP61794_P050

Host: Rabbit
Target Name: Pdgfc
Sample Type: Mouse Heart lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pdgfc
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Pdgfc (ARP61794_P050) antibody is Catalog # AAP61794

Target Info

• Gene Symbol: Pdgfc
• Gene Full Name: platelet derived growth factor C
• Alias Symbols: PDGF-, SCDGF, PDGF-C, VEGF-E, AI647969, 1110064L01Rik
• NCBI Gene Id: 54635
• Protein Name: Platelet-derived growth factor C
• Description of Target: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing, where it appears to be involved in three stages: inflammation, proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function.
• Uniprot ID: Q8CI19
• Protein Accession #: NP_064355
• Nucleotide Accession #: NM_019971
• Protein Size (# AA): 345
• Molecular Weight: 39kDa