website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Pax8 antibody - C-terminal region (ARP34180_P050)

Description of Target:
Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
Gene Symbol:
Pax8
Official Gene Full Name:
Paired box gene 8
NCBI Gene Id:
18510
Alias Symbols:
Pax-8
Tissue Tool:
Find tissues and cell lines supported to express Pax8.
Protein Accession #:
NP_035170
Nucleotide Accession#:
NM_011040
Swissprot Id:
Q00288
Host:
Rabbit
Protein Name:
Paired box protein Pax-8
Protein Size (# AA):
457
Molecular Weight:
49kDa
Application:
WB
Partner Proteins:
Nkx2-1,Phf17
Product Format:
Lyophilized powder
Complete computational species homology data:
Pax8 antibody - C-terminal region (ARP34180_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Mouse, Rat, Bovine, Horse, Rabbit, Human, Pig, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Pax8 antibody
- ARP34180_P050
Peptide Sequence:
Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
Blocking Peptide:
For anti-Pax8 antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Pax8 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question