website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

Pax8 antibody - C-terminal region (ARP34180_P050)

Description of Target:
Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
Gene Symbol:
Official Gene Full Name:
Paired box gene 8
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Pax8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Pax8.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Paired box protein Pax-8
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
Jade1; Nkx2-1;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-Pax8 (ARP34180_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Pig; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-Pax8 (ARP34180_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
Blocking Peptide:
For anti-Pax8 (ARP34180_P050) antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Ask a Question