website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Pax8 antibody - C-terminal region (ARP34180_P050)

Description of Target:
Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
Gene Symbol:
Official Gene Full Name:
Paired box gene 8
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express Pax8.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Paired box protein Pax-8
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
Pax8 antibody - C-terminal region (ARP34180_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Mouse, Rat, Bovine, Horse, Rabbit, Human, Pig, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Pax8 antibody
- ARP34180_P050
Peptide Sequence:
Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
Blocking Peptide:
For anti-Pax8 antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Pax8 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for Pax8 antibody (ARP34180)

Product page for Pax8 antibody (ARP34180)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant PAX8 antibody; Loxodonta africana PAX8 antibody G3TS19 100%
African elephant PAX8 antibody; Loxodonta africana PAX8 antibody G3TQD7 100%
Bovine BT.24636 antibody; Bos taurus BT.24636 antibody F1MLH9 100%
Dog Cfa.3789 antibody; Canis familiaris Cfa.3789 antibody F1PRD5 100%
Dog Cfa.3789 antibody; Canis familiaris Cfa.3789 antibody F1PJT1 100%
Dog PAX8 antibody; Canis familiaris PAX8 antibody P47240 100%
Duckbill platypus PAX8 antibody; Ornithorhynchus anatinus PAX8 antibody F6U6F3 84%
Duckbill platypus PAX8 antibody; Ornithorhynchus anatinus PAX8 antibody F6U6E4 84%
Duckbill platypus PAX8 antibody; Ornithorhynchus anatinus PAX8 antibody F6U6D6 84%
Gray short-tailed opossum PAX8 antibody; Monodelphis domestica PAX8 antibody F6TW98 100%
Guinea pig PAX8 antibody; Cavia porcellus PAX8 antibody H0VKH7 92%
Horse LOC100065303 antibody; Equus caballus LOC100065303 antibody F6YRP4 100%
Human PAX8 antibody; Homo sapiens PAX8 antibody Q06710 100%
Human PAX8 antibody; Homo sapiens PAX8 antibody H0YJZ5 100%
Little brown bat PAX8 antibody; Myotis lucifugus PAX8 antibody G1PJG0 85%
Lowland gorilla PAX8 antibody; Gorilla gorilla gorilla PAX8 antibody G3SHE3 100%
Lowland gorilla PAX8 antibody; Gorilla gorilla gorilla PAX8 antibody G3QPK2 100%
Mouse PAX8 antibody; Mus musculus PAX8 antibody Q00288 100%
Northern white-cheeked gibbon PAX8 antibody; Nomascus leucogenys PAX8 antibody G1QP92 100%
Northern white-cheeked gibbon PAX8 antibody; Nomascus leucogenys PAX8 antibody G1QP83 100%
Rabbit PAX8 antibody; Oryctolagus cuniculus PAX8 antibody G1U7L7 100%
Rabbit PAX8 antibody; Oryctolagus cuniculus PAX8 antibody G1SL96 100%
Rat PAX8 antibody; Rattus norvegicus PAX8 antibody P51974 100%
Rhesus macaque PAX8 antibody; Macaca mulatta PAX8 antibody F6PPP9 100%
Small-eared galago PAX8 antibody; Otolemur garnettii PAX8 antibody H0X0J0 100%
Sumatran orangutan PAX8 antibody; Pongo abelii PAX8 antibody Q5R9M8 100%
Sumatran orangutan PAX8 antibody; Pongo abelii PAX8 antibody Q5R594 100%
Tasmanian devil PAX8 antibody; Sarcophilus harrisii PAX8 antibody G3WEJ8 100%
White-tufted-ear marmoset LOC100386350 antibody; Callithrix jacchus LOC100386350 antibody F6YFD4 100%
White-tufted-ear marmoset LOC100386350 antibody; Callithrix jacchus LOC100386350 antibody F6XTE9 100%
Ask a Question