website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

Pax8 antibody - C-terminal region (ARP34180_P050)

Description of Target:
Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
Gene Symbol:
Pax8
Official Gene Full Name:
Paired box gene 8
NCBI Gene Id:
18510
Alias Symbols:
Pax-8
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Pax8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Pax8.
Swissprot Id:
Q00288
Protein Accession #:
NP_035170
Nucleotide Accession #:
NM_011040
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Paired box protein Pax-8
Protein Size (# AA):
457
Molecular Weight:
49kDa
Application:
WB
Protein Interactions:
Jade1; Nkx2-1;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Pax8 antibody - C-terminal region (ARP34180_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Species Reactivity:
Mouse, Rat, Bovine, Horse, Rabbit, Human, Pig, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Pax8 antibody
- ARP34180_P050
Peptide Sequence:
Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
Blocking Peptide:
For anti-Pax8 antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question