website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Pax8 antibody - C-terminal region (ARP34180_P050)

  • Catalog#: ARP34180_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    Pax8
    NCBI Gene Id:
    18510
    Official Gene Full Name:
    Paired box gene 8
    Protein Name:
    Paired box protein Pax-8
    Swissprot Id:
    Q00288
    Protein Accession #:
    NP_035170
    Nucleotide Accession #:
    NM_011040
    Alias Symbols:
    Pax-8
    Description of Target:
    Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
    Protein Size (# AA):
    457
    Molecular Weight:
    49kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB, IHC
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express Pax8.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express Pax8.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-Pax8 (ARP34180_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Jade1; Nkx2-1;
    Blocking Peptide:
    For anti-Pax8 (ARP34180_P050) antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442)
    Datasheets / Downloads:
    Printable datasheet for anti-Pax8 (ARP34180_P050) antibody

    Product Protocol: PAX8 Antibody (ARP34180_P050) in Human Thyroid Tissue using Immunohistochemistry

    Aviva Systems Biology is the original manufacturer of this PAX8 antibody.
    Product Datasheet Link: PAX8 antibody ARP34180_P050

    Rabbit Anti-PAX8 Antibody
    Catalog Number: ARP34180_P050
    Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue
    Observed Staining: Nucleus in follicular cells
    Primary Antibody Concentration: N/A
    Other Working Concentrations: 1:600
    Secondary Antibody: Donkey anti-Rabbit-Cy3
    Secondary Antibody Concentration: 1:200
    Magnification: 20X
    Exposure Time: 0.5 - 2.0 sec

    Left to right:
    DAPI, PAX8 Ab, Merge

    Control Image:
    Control Antibody: Normal Rabbit IgG
    Control Antibody Concentration: 1:100

    Left to right:
    DAPI, Rabbit IgG, Merge

    Protocol:
    1. Normal adult human thyroid tissue was formalin fixed, embedded in paraffin wax, sectioned at 6 micron thickness and put on histological slides.
    2. After deparaffinization and rehydration, the low pH, heat-induced antigen retrieval method utilizing Sodium Citrate buffer was performed.
    3. The blocking buffer was 5% normal goat serum.
    4. Primary antibodies was diluted in antibody dilution buffer (1% Normal Donkey Serum) to the final testing dilution (1:100, 1:600, 1:1200).
    5. The appropriate anti-rabbit fluorescent-conjugated (Rhodamine:red or FITC:green) secondary antibody was applied and nuclei will be counterstained with DAPI (blue).
    6. A Negative control utilized a nonspecific rabbit IgG staining the same normal adult human thyroid tissue.

     
    X
    Ask a Question