website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - 11/26/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

Pax8 antibody - C-terminal region (ARP34180_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Description of Target:
Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
Gene Symbol:
Official Gene Full Name:
Paired box gene 8
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Pax8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Pax8.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Paired box protein Pax-8
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
Jade1; Nkx2-1;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-Pax8 (ARP34180_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Datasheets / Downloads:
Printable datasheet for anti-Pax8 (ARP34180_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
Blocking Peptide:
For anti-Pax8 (ARP34180_P050) antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocol: PAX8 Antibody (ARP34180_P050) in Human Thyroid Tissue using Immunohistochemistry

Aviva Systems Biology is the original manufacturer of this PAX8 antibody.
Product Datasheet Link: PAX8 antibody ARP34180_P050

Rabbit Anti-PAX8 Antibody
Catalog Number: ARP34180_P050
Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue
Observed Staining: Nucleus in follicular cells
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Left to right:
DAPI, PAX8 Ab, Merge

Control Image:
Control Antibody: Normal Rabbit IgG
Control Antibody Concentration: 1:100

Left to right:
DAPI, Rabbit IgG, Merge

1. Normal adult human thyroid tissue was formalin fixed, embedded in paraffin wax, sectioned at 6 micron thickness and put on histological slides.
2. After deparaffinization and rehydration, the low pH, heat-induced antigen retrieval method utilizing Sodium Citrate buffer was performed.
3. The blocking buffer was 5% normal goat serum.
4. Primary antibodies was diluted in antibody dilution buffer (1% Normal Donkey Serum) to the final testing dilution (1:100, 1:600, 1:1200).
5. The appropriate anti-rabbit fluorescent-conjugated (Rhodamine:red or FITC:green) secondary antibody was applied and nuclei will be counterstained with DAPI (blue).
6. A Negative control utilized a nonspecific rabbit IgG staining the same normal adult human thyroid tissue.

Ask a Question