ING3 antibody - middle region (ARP33347_P050)

Catalog#: ARP33347_P050

• Size: 50ug

Human heart

Human Placenta

• Description of Target: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed.
• Gene Symbol: ING3
• Official Gene Full Name: Inhibitor of growth family, member 3
• Alias Symbols: Eaf4; FLJ20089; ING2; p47ING3; MEAF4
• Protein Accession#: NP_061944
• Nucleotide Accession#: NM_019071
• Swissprot Id: Q9NXR8
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 418
• Molecular Weight: 47kDa
• Application: WB
• Partner Proteins: CALCOCO2, CCDC85B, EWSR1, MDFI, CALCOCO2, CCDC85B, EWSR1, MDFI
• Immunogen: The immunogen for anti-ING3 antibody: synthetic peptide directed towards the middle region of human ING3
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKE
• Blocking Peptide: For anti-ING3 antibody is Catalog # AAP33347 (Previous Catalog # AAPP04389)
• Key Reference: Gunduz,M., (2008) Cancer Sci. 99 (3), 531-538
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-ING3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: ING3 antibody tested with Human Fetal Heart Tissue (ARP33347_P050)

Aviva Systems Biology is the original manufacturer of this ING3 antibody (ARP33347_P050)

Click here to view the ING3 antibody Western Blot Protocol

Product Datasheet Link: ING3 antibody (ARP33347_P050)

WB Suggested Anti-ING3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Heart

Western Blot image:


Description of Target: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ING3 antibody (ARP33347_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com