- Description of Target:
- Pax8 is thought to encode a transcription factor. It may have a role in kidney cell differentiation. It may play a regulatory role in mammalian development.
- Gene Symbol:
- Pax8
- Official Gene Full Name:
- Paired box gene 8
- Alias Symbols:
- Pax-8
- Tissue Tool:
- Find tissues and cell lines supported to express Pax8.
- Protein Accession# :
- NP_035170
- Nucleotide Accession#:
- NM_011040
- Swissprot Id:
- Q00288
- Host:
- Rabbit
- Protein Size (# AA):
- 457
- Molecular Weight:
- 49kDa
- Application:
- WB
- Partner Proteins:
- Nkx2-1,Phf17
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Pax8 antibody - C-terminal region (ARP34180_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-Pax8 antibody
- ARP34180_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
- Blocking Peptide:
- For anti-Pax8 antibody is Catalog # AAP34180 (Previous Catalog # AAPP05442)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Pax8 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
