- Description of Target:
- This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein
- Gene Symbol:
- PRKX
- Official Gene Full Name:
- Protein kinase, X-linked
- Alias Symbols:
- PKX1
- Tissue Tool:
- Find tissues and cell lines supported to express PRKX.
- Protein Accession# :
- NP_005035
- Nucleotide Accession#:
- NM_005044
- Swissprot Id:
- P51817
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 358
- Molecular Weight:
- 41kDa
- Application:
- WB
- Partner Proteins:
- BMPR2, HSPA1A, MYOD1, MYOD1
- Immunogen:
- The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- PRKX antibody - N-terminal region (ARP56626_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-PRKX antibody
- ARP56626_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
- Blocking Peptide:
- For anti-PRKX antibody is Catalog # AAP56626 (Previous Catalog # AAPP39331)
- Key Reference:
- Li,X., (2008) Biochim. Biophys. Acta 1782 (1), 1-9
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-PRKX antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: PRKX antibody tested with Human Hepg2 Cells (ARP56626_P050)
Aviva Systems Biology is the original manufacturer of this PRKX antibody (ARP56626_P050)
Click here to view the PRKX antibody Western Blot Protocol
Product Datasheet Link: PRKX antibody (ARP56626_P050)
WB Suggested Anti-PRKX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2
Western Blot image: 
Description of Target: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s PRKX antibody (ARP56626_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
