website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PRKAR1B antibody - middle region (ARP56420_P050)

Description of Target:
Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion
Gene Symbol:
Official Gene Full Name:
Protein kinase, cAMP-dependent, regulatory, type I, beta
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express PRKAR1B.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
cAMP-dependent protein kinase type I-beta regulatory subunit
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-PRKAR1B antibody: synthetic peptide directed towards the middle region of human PRKAR1B
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
PRKAR1B antibody - middle region (ARP56420_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 92%; Sheep: 85%; Rabbit: 85%
Species Reactivity:
Human, Mouse, Rat, Dog, Zebrafish, Pig, Bovine, Guinea pig, Horse, Sheep, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-PRKAR1B antibody
- ARP56420_P050
Peptide Sequence:
Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Blocking Peptide:
For anti-PRKAR1B antibody is Catalog # AAPP38729
Target Reference:
Zhan,X. (2006) Anal. Biochem. 354 (2), 279-289
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PRKAR1B antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for PRKAR1B antibody (ARP56420)

Product page for PRKAR1B antibody (ARP56420)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog prkar1a antibody; Xenopus laevis prkar1a antibody Q6INK7 84%
African clawed frog prkar1b antibody; Xenopus laevis prkar1b antibody Q6DJJ2 84%
African elephant PRKAR1A antibody; Loxodonta africana PRKAR1A antibody G3SLL5 84%
African elephant PRKAR1B antibody; Loxodonta africana PRKAR1B antibody G3U963 100%
African elephant PRKAR1B antibody; Loxodonta africana PRKAR1B antibody G3TQ81 100%
Bovine KAP0 antibody; Bos taurus KAP0 antibody P00514 84%
Bovine PRKAR1B antibody; Bos taurus PRKAR1B antibody Q17QF5 100%
Bovine PRKAR1B antibody; Bos taurus PRKAR1B antibody G3N3X4 100%
California sea hare KAPR antibody; Aplysia californica KAPR antibody P31319 76%
Chicken KAP0 antibody; Gallus gallus KAP0 antibody Q5ZM91 84%
Chicken PRKAR1A antibody; Gallus gallus PRKAR1A antibody E1BRS5 84%
Chicken PRKAR1B antibody; Gallus gallus PRKAR1B antibody E1C2U6 100%
Chinese hamster Prkar1a antibody; Cricetulus griseus Prkar1a antibody G3H853 84%
Common turkey LOC100543268 antibody; Meleagris gallopavo LOC100543268 antibody G1N579 84%
Common turkey PRKAR1B antibody; Meleagris gallopavo PRKAR1B antibody G1MSK2 100%
Dog PRKAR1A antibody; Canis familiaris PRKAR1A antibody E2QZV5 84%
Dog PRKAR1A antibody; Canis familiaris PRKAR1A antibody E2QXF1 84%
Dog PRKAR1B antibody; Canis familiaris PRKAR1B antibody F1Q3L1 100%
Duckbill platypus PRKAR1B antibody; Ornithorhynchus anatinus PRKAR1B antibody F7CXM1 100%
Duckbill platypus PRKAR1B antibody; Ornithorhynchus anatinus PRKAR1B antibody F7CXL4 100%
European seabass PRKAR1A antibody; Dicentrarchus labrax PRKAR1A antibody E6ZGR0 84%
Giant panda LOC100473970 antibody; Ailuropoda melanoleuca LOC100473970 antibody D2HSY1 84%
Giant panda PRKAR1B antibody; Ailuropoda melanoleuca PRKAR1B antibody D2I2Z1 100%
Gray short-tailed opossum PRKAR1B antibody; Monodelphis domestica PRKAR1B antibody F7CWN5 100%
Guinea pig LOC100713839 antibody; Cavia porcellus LOC100713839 antibody H0VMQ5 100%
Guinea pig PRKAR1A antibody; Cavia porcellus PRKAR1A antibody H0V2I5 84%
Horse LOC100053143 antibody; Equus caballus LOC100053143 antibody F7DX98 84%
Horse PRKAR1B antibody; Equus caballus PRKAR1B antibody F6PIA4 92%
Human KAP0 antibody; Homo sapiens KAP0 antibody P10644 84%
Human KAP1 antibody; Homo sapiens KAP1 antibody P31321 100%
Human PRKAR1A antibody; Homo sapiens PRKAR1A antibody Q68DQ4 84%
Human PRKAR1A antibody; Homo sapiens PRKAR1A antibody B2R5T5 84%
Little brown bat PRKAR1A antibody; Myotis lucifugus PRKAR1A antibody G1NVU2 84%
Lowland gorilla PRKAR1A antibody; Gorilla gorilla gorilla PRKAR1A antibody G3RK51 84%
Lowland gorilla PRKAR1B antibody; Gorilla gorilla gorilla PRKAR1B antibody G3R8D7 100%
Mouse KAP0 antibody; Mus musculus KAP0 antibody Q9DBC7 84%
Mouse KAP1 antibody; Mus musculus KAP1 antibody P12849 100%
Mouse Prkar1a antibody; Mus musculus Prkar1a antibody Q9CS50 84%
Mouse Prkar1a antibody; Mus musculus Prkar1a antibody Q3UBA7 84%
Mouse Prkar1a antibody; Mus musculus Prkar1a antibody Q3TYK4 84%
Mouse Prkar1a antibody; Mus musculus Prkar1a antibody A2AI68 84%
Mouse Prkar1b antibody; Mus musculus Prkar1b antibody Q3TY04 100%
Mouse Prkar1b antibody; Mus musculus Prkar1b antibody D3Z0V6 100%
Mouse Prkar1b antibody; Mus musculus Prkar1b antibody Q921L9 100%
Northern white-cheeked gibbon PRKAR1A antibody; Nomascus leucogenys PRKAR1A antibody G1QNN3 84%
Northern white-cheeked gibbon PRKAR1B antibody; Nomascus leucogenys PRKAR1B antibody G1RA30 100%
Pig KAP0 antibody; Sus scrofa KAP0 antibody P07802 84%
Pig PRKAR1A antibody; Sus scrofa PRKAR1A antibody F1RV23 84%
Pig PRKAR1B antibody; Sus scrofa PRKAR1B antibody F1RIY9 100%
Rat KAP0 antibody; Rattus norvegicus KAP0 antibody P09456 84%
Rat KAP1 antibody; Rattus norvegicus KAP1 antibody P81377 100%
Rat Prkar1a antibody; Rattus norvegicus Prkar1a antibody Q6LCA5 84%
Rat Prkar1b antibody; Rattus norvegicus Prkar1b antibody Q5BJR2 100%
Rat Prkar1b antibody; Rattus norvegicus Prkar1b antibody Q3SWU5 100%
Rat Prkar1b antibody; Rattus norvegicus Prkar1b antibody F1M9X5 100%
Rhesus macaque Mmu.681 antibody; Macaca mulatta Mmu.681 antibody F6WM87 84%
salmon louse KAPR1 antibody; Lepeophtheirus salmonis KAPR1 antibody D3PGM7 92%
Sheep PRKAR1A antibody; Ovis aries PRKAR1A antibody B6Z9S4 84%
Small-eared galago PRKAR1A antibody; Otolemur garnettii PRKAR1A antibody H0XDN5 84%
Small-eared galago PRKAR1B antibody; Otolemur garnettii PRKAR1B antibody H0WUN6 100%
Sumatran orangutan KAP0 antibody; Pongo abelii KAP0 antibody Q5REL1 84%
Tasmanian devil PRKAR1A antibody; Sarcophilus harrisii PRKAR1A antibody G3W1N0 84%
Tasmanian devil PRKAR1B antibody; Sarcophilus harrisii PRKAR1B antibody G3WA12 100%
Tasmanian devil PRKAR1B antibody; Sarcophilus harrisii PRKAR1B antibody G3WA11 100%
Three-spined stickleback PRKAR1A antibody; Gasterosteus aculeatus PRKAR1A antibody G3P5I7 84%
Three-spined stickleback PRKAR1B antibody; Gasterosteus aculeatus PRKAR1B antibody G3PBV0 100%
Transparent sea squirt Cin.26387 antibody; Ciona intestinalis Cin.26387 antibody F7B2Q7 92%
Western clawed frog prkar1a antibody; Xenopus tropicalis prkar1a antibody F6ZV19 100%
Western clawed frog prkar1a antibody; Xenopus tropicalis prkar1a antibody Q5BL84 84%
Western clawed frog prkar1b antibody; Xenopus tropicalis prkar1b antibody Q0P4Y3 100%
White-tufted-ear marmoset LOC100412550 antibody; Callithrix jacchus LOC100412550 antibody F6QGT4 100%
White-tufted-ear marmoset PRKAR1A antibody; Callithrix jacchus PRKAR1A antibody F7H7M3 84%
Zebra finch LOC100229911 antibody; Taeniopygia guttata LOC100229911 antibody H0ZDW3 100%
Zebra finch Tgu.3588 antibody; Taeniopygia guttata Tgu.3588 antibody H0Z0Y4 84%
Zebrafish prkar1aa antibody; Danio rerio prkar1aa antibody Q5I0F6 84%
Zebrafish prkar1ab antibody; Danio rerio prkar1ab antibody Q567D1 84%
Zebrafish prkar1ab antibody; Danio rerio prkar1ab antibody F1QEC8 84%
Zebrafish prkar1b antibody; Danio rerio prkar1b antibody Q08C49 100%
Zebrafish prkar1b antibody; Danio rerio prkar1b antibody F1QWS8 100%

Product Protocols: PRKAR1B antibody tested with Human Fetal Heart Tissue (ARP56420_P050)

Aviva Systems Biology is the original manufacturer of this PRKAR1B antibody (ARP56420_P050)

Click here to view the PRKAR1B antibody Western Blot Protocol

Product Datasheet Link: PRKAR1B antibody (ARP56420_P050)

WB Suggested Anti-PRKAR1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Heart

Western Blot image:

Description of Target: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PRKAR1B antibody (ARP56420_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question