website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

PRKAR1B antibody - middle region (ARP56420_P050)

Description of Target:
Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion
Gene Symbol:
PRKAR1B
Official Gene Full Name:
Protein kinase, cAMP-dependent, regulatory, type I, beta
NCBI Gene Id:
5575
Alias Symbols:
PRKAR1
Tissue Tool:
Find tissues and cell lines supported to express PRKAR1B.
Protein Accession #:
NP_002726
Nucleotide Accession#:
NM_002735
Swissprot Id:
P31321
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
cAMP-dependent protein kinase type I-beta regulatory subunit
Protein Size (# AA):
381
Molecular Weight:
43kDa
Application:
WB
Partner Proteins:
ADRBK1, AFAP1, ANXA2, ANXA7, BMPR2, BTK, CARD11, CASR, CD5, CHAT, CHUK, CISH, CSF2RB, CYTH2, DAB2, DVL2, EIF4E, EIF6, EPB41, GABRB2, GABRG2, GAP43, GCNT1, GJA1, GNA13, GNB2L1, GRIN1, GRIN2B, GRIN2D, GRM5, GSK3A, GSK3B, HABP4, IFNAR2, IKBKB, ITGB2, ITGB7, KIT, LMNB1, LST1, MAPK6, MARCKS, MKI67, NCF
Immunogen:
The immunogen for anti-PRKAR1B antibody: synthetic peptide directed towards the middle region of human PRKAR1B
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
PRKAR1B antibody - middle region (ARP56420_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 92%; Sheep: 85%; Rabbit: 85%
Species Reactivity:
Human, Mouse, Rat, Dog, Zebrafish, Pig, Bovine, Guinea pig, Horse, Sheep, Rabbit
Datasheets / Downloads:
Printable datasheet for
anti-PRKAR1B antibody
- ARP56420_P050
Peptide Sequence:
Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Blocking Peptide:
For anti-PRKAR1B antibody is Catalog # AAPP38729
Key Reference:
Zhan,X. (2006) Anal. Biochem. 354 (2), 279-289
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PRKAR1B antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question