website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

PRKAR1B antibody - middle region (ARP56420_P050)

Description of Target:
Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion
Gene Symbol:
PRKAR1B
Official Gene Full Name:
Protein kinase, cAMP-dependent, regulatory, type I, beta
NCBI Gene Id:
5575
Alias Symbols:
PRKAR1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKAR1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKAR1B.
Swissprot Id:
P31321
Protein Accession #:
NP_002726
Nucleotide Accession #:
NM_002735
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
cAMP-dependent protein kinase type I-beta regulatory subunit
Protein Size (# AA):
381
Molecular Weight:
43kDa
Application:
WB
Protein Interactions:
UBC; DUS3L; THG1L; EEF2K; CALU; PRKACB; PRKACA; Dlg4; CUL3; WNK1; EGFR; PPP1R9A; WRN; SMAD3; AKAP1; SMAD4; PRKAR1A; PRKAR1B;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRKAR1B
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-PRKAR1B (ARP56420_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Sheep: 85%; Zebrafish: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Sheep; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-PRKAR1B (ARP56420_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Blocking Peptide:
For anti-PRKAR1B (ARP56420_P050) antibody is Catalog # AAPP38729
Target Reference:
Zhan,X. (2006) Anal. Biochem. 354 (2), 279-289
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: PRKAR1B antibody tested with Human Fetal Heart Tissue (ARP56420_P050)

Aviva Systems Biology is the original manufacturer of this PRKAR1B antibody (ARP56420_P050)

Click here to view the PRKAR1B antibody Western Blot Protocol

Product Datasheet Link: PRKAR1B antibody (ARP56420_P050)

WB Suggested Anti-PRKAR1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Fetal Heart

Western Blot image:


Description of Target: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PRKAR1B antibody (ARP56420_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question