- Description of Target:
- Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
- Gene Symbol:
- Ppp3cb
- Official Gene Full Name:
- Protein phosphatase 3, catalytic subunit, beta isoform
- Alias Symbols:
- 1110063J16Rik; Calnb; CnAbeta; Cnab
- Tissue Tool:
- Find tissues and cell lines supported to express Ppp3cb.
- Protein Accession# :
- NP_032940
- Nucleotide Accession#:
- NM_008914
- Swissprot Id:
- P48453
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 525
- Molecular Weight:
- 58kDa
- Application:
- WB
- Subunit:
- beta isoform
- Immunogen:
- The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Ppp3cb antibody - C-terminal region (ARP57516_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 92%; Zebrafish: 78%
- Datasheets / Downloads:
- Printable datasheet for
anti-Ppp3cb antibody
- ARP57516_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI
- Blocking Peptide:
- For anti-Ppp3cb antibody is Catalog # AAP57516 (Previous Catalog # AAPP41630)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Ppp3cb antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
