website statistics
Account Login 

Aviva Systems Biology office will be closed for Memorial Day - 5/25/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

PIK3CB antibody - C-terminal region (ARP32117_T100)

Description of Target:
Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].
Gene Symbol:
PIK3CB
Official Gene Full Name:
Phosphoinositide-3-kinase, catalytic, beta polypeptide
NCBI Gene Id:
5291
Alias Symbols:
PI3K; PIK3C1; P110BETA; PI3KBETA
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIK3CB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIK3CB.
Swissprot Id:
Q24JU2
Protein Accession #:
NP_006210
Nucleotide Accession #:
NM_006219
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
Protein Size (# AA):
1070
Molecular Weight:
123kDa
Application:
WB
Subunit:
beta isoform
Protein Interactions:
EGFR; IRS1; GRB2; PIK3R1; GAB2; PIK3R2; CRK; CBL; RAB5A; UBC; ALAS1; HPS6; DVL3; ALK; AGTR2; PRKCD; PRKCE; YWHAQ; HCK; MME;
Immunogen:
The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
PIK3CB antibody - C-terminal region (ARP32117_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Human, Dog, Zebrafish, Rat, Bovine, Horse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-PIK3CB antibody
- ARP32117_T100
Peptide Sequence:
Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
Blocking Peptide:
For anti-PIK3CB antibody is Catalog # AAP32117 (Previous Catalog # AAPP03034)
Target Reference:
Zhao,J.J., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (51), 18443-18448
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: PIK3CB antibody tested with Human Fetal Brain Tissue (ARP32117_T100)

Aviva Systems Biology is the original manufacturer of this PIK3CB antibody (ARP32117_T100)

Click here to view the PIK3CB antibody Western Blot Protocol

Product Datasheet Link: PIK3CB antibody (ARP32117_T100)

WB Suggested Anti-PIK3CB Antibody Titration: 5ug/ml
Positive Control: Fetal brain

Western Blot image:


Description of Target: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s PIK3CB antibody (ARP32117_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question