website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PIK3CB antibody - C-terminal region (ARP32117_T100)

Description of Target:
Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].
Gene Symbol:
Official Gene Full Name:
Phosphoinositide-3-kinase, catalytic, beta polypeptide
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express PIK3CB.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
Protein Size (# AA):
Molecular Weight:
beta isoform
Protein Interactions:
The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
PIK3CB antibody - C-terminal region (ARP32117_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Human, Dog, Zebrafish, Rat, Bovine, Horse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-PIK3CB antibody
- ARP32117_T100
Peptide Sequence:
Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
Blocking Peptide:
For anti-PIK3CB antibody is Catalog # AAP32117 (Previous Catalog # AAPP03034)
Target Reference:
Zhao,J.J., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (51), 18443-18448
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for PIK3CB antibody (ARP32117)

Product page for PIK3CB antibody (ARP32117)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant PIK3CB antibody; Loxodonta africana PIK3CB antibody G3UI53 100%
African elephant PIK3CB antibody; Loxodonta africana PIK3CB antibody G3TFN6 100%
African elephant PIK3CD antibody; Loxodonta africana PIK3CD antibody G3SNN8 85%
Bovine PIK3CB antibody; Bos taurus PIK3CB antibody G3MWH3 100%
Bovine PIK3CB antibody; Bos taurus PIK3CB antibody F1MYM3 100%
Bovine PIK3CD antibody; Bos taurus PIK3CD antibody E1BE66 85%
Chicken PIK3CB antibody; Gallus gallus PIK3CB antibody Q5F4A2 100%
Chicken PIK3CD antibody; Gallus gallus PIK3CD antibody Q5F3P4 85%
Chicken PIK3CD antibody; Gallus gallus PIK3CD antibody F1NHX1 85%
Common turkey LOC100543492 antibody; Meleagris gallopavo LOC100543492 antibody G1MY67 85%
Common turkey PIK3CB antibody; Meleagris gallopavo PIK3CB antibody G5E801 100%
Common turkey PIK3CB antibody; Meleagris gallopavo PIK3CB antibody G1MYU3 100%
Common turkey PIK3CD antibody; Meleagris gallopavo PIK3CD antibody G3UQL7 85%
Dog PIK3CB antibody; Canis familiaris PIK3CB antibody E2R721 100%
Dog PIK3CD antibody; Canis familiaris PIK3CD antibody E2QW08 85%
Duckbill platypus PIK3CD antibody; Ornithorhynchus anatinus PIK3CD antibody F7EMH6 85%
Duckbill platypus PIK3CD antibody; Ornithorhynchus anatinus PIK3CD antibody F7EMH1 85%
Giant panda PIK3CB antibody; Ailuropoda melanoleuca PIK3CB antibody D2I0M7 100%
Giant panda PIK3CD antibody; Ailuropoda melanoleuca PIK3CD antibody G1LBP1 85%
Gray short-tailed opossum PIK3CB antibody; Monodelphis domestica PIK3CB antibody F7FDA0 100%
Gray short-tailed opossum PIK3CB antibody; Monodelphis domestica PIK3CB antibody F6Y7N7 100%
Gray short-tailed opossum PIK3CB antibody; Monodelphis domestica PIK3CB antibody F6Y7M7 100%
Gray short-tailed opossum PIK3CB antibody; Monodelphis domestica PIK3CB antibody F6Y7L9 100%
Green anole PIK3CB antibody; Anolis carolinensis PIK3CB antibody G1KBQ4 100%
Guinea pig PIK3CB antibody; Cavia porcellus PIK3CB antibody H0UUY5 100%
Guinea pig Pik3cd antibody; Cavia porcellus Pik3cd antibody H0VMM3 85%
Horse PIK3CB antibody; Equus caballus PIK3CB antibody F6X8V3 100%
Horse PIK3CD antibody; Equus caballus PIK3CD antibody F7DHK6 85%
Human PIK3CB antibody; Homo sapiens PIK3CB antibody Q9BTS4 100%
Human PIK3CB antibody; Homo sapiens PIK3CB antibody Q6PJ60 100%
Human PIK3CB antibody; Homo sapiens PIK3CB antibody Q68DL0 100%
Human PIK3CB antibody; Homo sapiens PIK3CB antibody H0Y871 100%
Human PIK3CB antibody; Homo sapiens PIK3CB antibody B4DER4 100%
Human PIK3CD antibody; Homo sapiens PIK3CD antibody Q5SR50 85%
Human PIK3CD antibody; Homo sapiens PIK3CD antibody Q59HC4 85%
Human PIK3CD antibody; Homo sapiens PIK3CD antibody Q1WIR0 85%
Human PIK3CD antibody; Homo sapiens PIK3CD antibody Q1WIQ9 85%
Human PIK3CD antibody; Homo sapiens PIK3CD antibody B7ZM44 85%
Human PIK3CD antibody; Homo sapiens PIK3CD antibody A7E2E0 85%
Human PIK3CD antibody; Homo sapiens PIK3CD antibody O00334 78%
Human PK3CB antibody; Homo sapiens PK3CB antibody P42338 100%
Human PK3CD antibody; Homo sapiens PK3CD antibody O00329 85%
Little brown bat PIK3CB antibody; Myotis lucifugus PIK3CB antibody G1NSK5 100%
Little brown bat PIK3CD antibody; Myotis lucifugus PIK3CD antibody G1PAN1 85%
Lowland gorilla PIK3CB antibody; Gorilla gorilla gorilla PIK3CB antibody G3R2C2 100%
Lowland gorilla PIK3CD antibody; Gorilla gorilla gorilla PIK3CD antibody G3R9L0 85%
Mouse Pik3cb antibody; Mus musculus Pik3cb antibody Q9CTK7 100%
Mouse Pik3cb antibody; Mus musculus Pik3cb antibody Q3TNJ8 100%
Mouse Pik3cb antibody; Mus musculus Pik3cb antibody A0JNZ1 100%
Mouse Pik3cd antibody; Mus musculus Pik3cd antibody Q8CI98 85%
Mouse Pik3cd antibody; Mus musculus Pik3cd antibody Q8BS14 85%
Mouse Pik3cd antibody; Mus musculus Pik3cd antibody Q546P7 85%
Mouse Pik3cd antibody; Mus musculus Pik3cd antibody Q3UDT3 85%
Mouse Pik3cd antibody; Mus musculus Pik3cd antibody Q3TBW3 85%
Mouse Pik3cd antibody; Mus musculus Pik3cd antibody Q3T9Y0 85%
Mouse Pik3cd antibody; Mus musculus Pik3cd antibody B0QZL5 85%
Mouse PK3CB antibody; Mus musculus PK3CB antibody Q8BTI9 100%
Mouse PK3CD antibody; Mus musculus PK3CD antibody O35904 85%
Northern white-cheeked gibbon PIK3CB antibody; Nomascus leucogenys PIK3CB antibody G1QWH0 100%
Northern white-cheeked gibbon PIK3CD antibody; Nomascus leucogenys PIK3CD antibody G1RDT2 85%
Pig PIK3CD antibody; Sus scrofa PIK3CD antibody F1RIH5 85%
Rabbit PIK3CB antibody; Oryctolagus cuniculus PIK3CB antibody G1SMR9 100%
Rabbit PIK3CD antibody; Oryctolagus cuniculus PIK3CD antibody G1TVC1 85%
Rabbit PIK3CD antibody; Oryctolagus cuniculus PIK3CD antibody G1T0I7 85%
Rat Pik3cb antibody; Rattus norvegicus Pik3cb antibody G3V839 100%
Rat Pik3cd antibody; Rattus norvegicus Pik3cd antibody D3ZM86 85%
Rat Pik3cd antibody; Rattus norvegicus Pik3cd antibody D3ZB25 85%
Rat PK3CB antibody; Rattus norvegicus PK3CB antibody Q9Z1L0 100%
Rhesus macaque PIK3CB antibody; Macaca mulatta PIK3CB antibody F7F3S0 100%
Rhesus macaque PIK3CD antibody; Macaca mulatta PIK3CD antibody F7HLC7 85%
Small-eared galago PIK3CB antibody; Otolemur garnettii PIK3CB antibody H0WP19 100%
Small-eared galago PIK3CD antibody; Otolemur garnettii PIK3CD antibody H0XCZ2 85%
Sumatran orangutan DKFZp459O208 antibody; Pongo abelii DKFZp459O208 antibody Q5RCB5 100%
Three-spined stickleback PIK3CB antibody; Gasterosteus aculeatus PIK3CB antibody G3NQ48 100%
Three-spined stickleback PIK3CD antibody; Gasterosteus aculeatus PIK3CD antibody G3NWI2 85%
Western clawed frog pik3cb antibody; Xenopus tropicalis pik3cb antibody Q0IHS8 92%
Western clawed frog pik3cb antibody; Xenopus tropicalis pik3cb antibody F7E8J8 92%
Western clawed frog pik3cb antibody; Xenopus tropicalis pik3cb antibody F7DK15 92%
White-tufted-ear marmoset PIK3CB antibody; Callithrix jacchus PIK3CB antibody F7CM33 100%
White-tufted-ear marmoset PIK3CB antibody; Callithrix jacchus PIK3CB antibody F6YYH1 100%
White-tufted-ear marmoset PIK3CB antibody; Callithrix jacchus PIK3CB antibody F6RS95 100%
White-tufted-ear marmoset PIK3CD antibody; Callithrix jacchus PIK3CD antibody F6RS48 85%
White-tufted-ear marmoset PIK3CD antibody; Callithrix jacchus PIK3CD antibody F6RFR7 85%
Zebra finch PIK3CB antibody; Taeniopygia guttata PIK3CB antibody H0Z4J4 100%
Zebra finch Tgu.18698 antibody; Taeniopygia guttata Tgu.18698 antibody H0YZT0 85%
Zebrafish pik3cd antibody; Danio rerio pik3cd antibody Q7SYE7 85%
Zebrafish pik3cd antibody; Danio rerio pik3cd antibody F1RB17 85%
Zebrafish wu:fb92a07 antibody; Danio rerio wu:fb92a07 antibody E7F251 100%

Product Protocols: PIK3CB antibody tested with Human Fetal Brain Tissue (ARP32117_T100)

Aviva Systems Biology is the original manufacturer of this PIK3CB antibody (ARP32117_T100)

Click here to view the PIK3CB antibody Western Blot Protocol

Product Datasheet Link: PIK3CB antibody (ARP32117_T100)

WB Suggested Anti-PIK3CB Antibody Titration: 5ug/ml
Positive Control: Fetal brain

Western Blot image:

Description of Target: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PIK3CB antibody (ARP32117_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question