website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

PIK3CB antibody - C-terminal region (ARP32117_T100)

Description of Target:
Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993).[supplied by OMIM].
Gene Symbol:
PIK3CB
Official Gene Full Name:
Phosphoinositide-3-kinase, catalytic, beta polypeptide
NCBI Gene Id:
5291
Alias Symbols:
PI3K; PIK3C1; P110BETA; PI3KBETA
Tissue Tool:
Find tissues and cell lines supported to express PIK3CB.
Protein Accession #:
NP_006210
Nucleotide Accession#:
NM_006219
Swissprot Id:
Q24JU2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
Protein Size (# AA):
1070
Molecular Weight:
123kDa
Application:
WB
Subunit:
beta isoform
Partner Proteins:
FZD8, RYK, FZD8, FZD9, LRP5, LRP6, PORCN, RYK, SFRP1, SFRP2, WNT3A, FZD8, LRP6, SFRP1
Immunogen:
The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
PIK3CB antibody - C-terminal region (ARP32117_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Human, Dog, Zebrafish, Rat, Bovine, Horse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-PIK3CB antibody
- ARP32117_T100
Peptide Sequence:
Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
Blocking Peptide:
For anti-PIK3CB antibody is Catalog # AAP32117 (Previous Catalog # AAPP03034)
Key Reference:
Zhao,J.J., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (51), 18443-18448
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-PIK3CB antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question