website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PRKAR1B antibody - middle region (ARP56420_P050)

  • Catalog#: ARP56420_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock
    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    PRKAR1B
    NCBI Gene Id:
    5575
    Official Gene Full Name:
    Protein kinase, cAMP-dependent, regulatory, type I, beta
    Protein Name:
    cAMP-dependent protein kinase type I-beta regulatory subunit
    Swissprot Id:
    P31321
    Protein Accession #:
    NP_002726
    Nucleotide Accession #:
    NM_002735
    Alias Symbols:
    PRKAR1
    Replacement Item:
    This antibody may replace item sc-100414 from Santa Cruz Biotechnology.
    Description of Target:
    Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion
    Protein Size (# AA):
    381
    Molecular Weight:
    43kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express PRKAR1B.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express PRKAR1B.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human PRKAR1B
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Sheep: 85%; Zebrafish: 100%
    Complete computational species homology data:
    Anti-PRKAR1B (ARP56420_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; DUS3L; THG1L; EEF2K; CALU; PRKACB; PRKACA; Dlg4; CUL3; WNK1; EGFR; PPP1R9A; WRN; SMAD3; AKAP1; SMAD4; PRKAR1A; PRKAR1B;
    Blocking Peptide:
    For anti-PRKAR1B (ARP56420_P050) antibody is Catalog # AAPP38729
    Datasheets / Downloads:
    Printable datasheet for anti-PRKAR1B (ARP56420_P050) antibody
    Target Reference:
    Zhan,X. (2006) Anal. Biochem. 354 (2), 279-289

    Product Protocols: PRKAR1B antibody tested with Human Fetal Heart Tissue (ARP56420_P050)

    Aviva Systems Biology is the original manufacturer of this PRKAR1B antibody (ARP56420_P050)

    Click here to view the PRKAR1B antibody Western Blot Protocol

    Product Datasheet Link: PRKAR1B antibody (ARP56420_P050)

    WB Suggested Anti-PRKAR1B Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:1562500
    Positive Control: Fetal Heart

    Western Blot image:


    Description of Target: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s PRKAR1B antibody (ARP56420_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question