website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

RBM10 antibody - N-terminal region (ARP30104_T100)

Description of Target:
RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
Gene Symbol:
Official Gene Full Name:
RNA binding motif protein 10
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

RBM10 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Tissue Tool:
Find tissues and cell lines supported to express RBM10.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
RNA-binding protein 10
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
RBM10 antibody - N-terminal region (ARP30104_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%
Species Reactivity:
Bovine, Horse, Rabbit, Rat, Guinea pig, Human, Mouse, Dog
Datasheets / Downloads:
Printable datasheet for
anti-RBM10 antibody
- ARP30104_T100
Peptide Sequence:
Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
Blocking Peptide:
For anti-RBM10 antibody is Catalog # AAP30104 (Previous Catalog # AAPH00280)
Target Reference:
Thiselton,D.L., et al., (2002) Genomics 79 (4), 560-572
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for RBM10 antibody (ARP30104)

Product page for RBM10 antibody (ARP30104)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant RBM10 antibody; Loxodonta africana RBM10 antibody G3UN09 100%
African elephant RBM10 antibody; Loxodonta africana RBM10 antibody G3SRC2 100%
Bovine RBM10 antibody; Bos taurus RBM10 antibody F1MFZ9 100%
Dog RBM10 antibody; Canis familiaris RBM10 antibody F1PDM2 92%
Duckbill platypus RBM10 antibody; Ornithorhynchus anatinus RBM10 antibody F7EC91 84%
Gray short-tailed opossum RBM10 antibody; Monodelphis domestica RBM10 antibody F7D4U6 84%
Guinea pig RBM10 antibody; Cavia porcellus RBM10 antibody H0UZQ1 100%
Horse RBM10 antibody; Equus caballus RBM10 antibody F6X7R7 100%
Human RBM10 antibody; Homo sapiens RBM10 antibody P98175 100%
Human RBM10 antibody; Homo sapiens RBM10 antibody P98175-2 100%
Human RBM10 antibody; Homo sapiens RBM10 antibody Q7Z3D7 100%
Lowland gorilla RBM10 antibody; Gorilla gorilla gorilla RBM10 antibody G3SHS2 100%
Lowland gorilla RBM10 antibody; Gorilla gorilla gorilla RBM10 antibody G3QXY4 100%
Mouse RBM10 antibody; Mus musculus RBM10 antibody Q99KG3 100%
Mouse RBM10 antibody; Mus musculus RBM10 antibody Q99KG3-3 100%
Northern white-cheeked gibbon RBM10 antibody; Nomascus leucogenys RBM10 antibody G1QS19 100%
Northern white-cheeked gibbon RBM10 antibody; Nomascus leucogenys RBM10 antibody G1QS12 100%
Pig RBM10 antibody; Sus scrofa RBM10 antibody F1RWX6 100%
Rabbit RBM10 antibody; Oryctolagus cuniculus RBM10 antibody G1U8V3 100%
Rabbit RBM10 antibody; Oryctolagus cuniculus RBM10 antibody G1TZN2 100%
Rhesus macaque RBM10 antibody; Macaca mulatta RBM10 antibody F7HPQ5 100%
Rhesus macaque RBM10 antibody; Macaca mulatta RBM10 antibody F7BRT1 100%
Rhesus macaque RBM10 antibody; Macaca mulatta RBM10 antibody F7HPQ3 100%
Small-eared galago RBM10 antibody; Otolemur garnettii RBM10 antibody H0WYQ3 100%
Tasmanian devil RBM10 antibody; Sarcophilus harrisii RBM10 antibody G3W0G4 84%
White-tufted-ear marmoset RBM10 antibody; Callithrix jacchus RBM10 antibody F7C8M8 100%

Product Protocols: RBM10 antibody tested with Human Daudi Cells (ARP30104_T100)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody (ARP30104_T100)

Click here to view the RBM10 antibody Western Blot Protocol

Product Datasheet Link: RBM10 antibody (ARP30104_T100)

WB Suggested Anti-RBM10 Antibody Titration: 1.4ug/ml
ELISA Titer: 1:1562500
Positive Control: Daudi

Western Blot image:

Description of Target: RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s RBM10 antibody (ARP30104_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: RBM10 antibody tested by IHC with human lung (ARP30104)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody.

Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: RBM10 antibody (ARP30104)

IHC Information:

Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Lung
Cellular Data: Epithelial cells of bronchiole
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: RBM10 antibody tested by IHC with human heart (ARP30104)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody.

Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: RBM10 antibody (ARP30104)

IHC Information:

Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question