website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$229.00
In Stock

RBM10 antibody - N-terminal region (ARP30104_T100)

Description of Target:
RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
Gene Symbol:
RBM10
Official Gene Full Name:
RNA binding motif protein 10
NCBI Gene Id:
8241
Alias Symbols:
S1-1; TARPS; GPATC9; ZRANB5; GPATCH9; DXS8237E
Sample Type Confirmation:

RBM10 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Tissue Tool:
Find tissues and cell lines supported to express RBM10.
Protein Accession #:
NP_005667
Nucleotide Accession#:
NM_005676
Swissprot Id:
P98175
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
RNA-binding protein 10
Protein Size (# AA):
930
Molecular Weight:
104kDa
Application:
IHC, WB
Protein Interactions:
TBC1D22B; AES; SUMO2; UBC; RPA3; RPA2; RPA1; ASB12; ZBTB1; FBXO6; PTBP2; LMNA; PAN2; SUGP1; CCAR1; PRPF19; GPKOW; U2SURP; U2AF2; SF3A1; SF3B4; DHX38; RBM10; SF1; WHSC1; U2AF1; SNRPC; SRSF6; RBM4; PTBP1; PRCC; IK; HNRNPK; HNRNPH2; DHX15; DDX5; CSNK2A1; SMU
Immunogen:
The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Protein A purified
Complete computational species homology data:
RBM10 antibody - N-terminal region (ARP30104_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%
Species Reactivity:
Bovine, Horse, Rabbit, Rat, Guinea pig, Human, Mouse, Dog
Datasheets / Downloads:
Printable datasheet for
anti-RBM10 antibody
- ARP30104_T100
Peptide Sequence:
Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
Blocking Peptide:
For anti-RBM10 antibody is Catalog # AAP30104 (Previous Catalog # AAPH00280)
Target Reference:
Thiselton,D.L., et al., (2002) Genomics 79 (4), 560-572
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: RBM10 antibody tested with Human Daudi Cells (ARP30104_T100)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody (ARP30104_T100)

Click here to view the RBM10 antibody Western Blot Protocol

Product Datasheet Link: RBM10 antibody (ARP30104_T100)

WB Suggested Anti-RBM10 Antibody Titration: 1.4ug/ml
ELISA Titer: 1:1562500
Positive Control: Daudi

Western Blot image:


Description of Target: RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RBM10 antibody (ARP30104_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: RBM10 antibody tested by IHC with human lung (ARP30104)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody.

Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: RBM10 antibody (ARP30104)

IHC Information:

Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Lung
Cellular Data: Epithelial cells of bronchiole
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: RBM10 antibody tested by IHC with human heart (ARP30104)

Aviva Systems Biology is the original manufacturer of this RBM10 antibody.

Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: RBM10 antibody (ARP30104)

IHC Information:

Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question