website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

RBM10 antibody - N-terminal region (ARP30104_T100)

Description of Target:
RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
Gene Symbol:
Official Gene Full Name:
RNA binding motif protein 10
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

RBM10 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Tissue Tool:
Find tissues and cell lines supported to express RBM10.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
RNA-binding protein 10
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
RBM10 antibody - N-terminal region (ARP30104_T100)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%
Species Reactivity:
Bovine, Horse, Rabbit, Rat, Guinea pig, Human, Mouse, Dog
Datasheets / Downloads:
Printable datasheet for
anti-RBM10 antibody
- ARP30104_T100
Peptide Sequence:
Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
Blocking Peptide:
For anti-RBM10 antibody is Catalog # AAP30104 (Previous Catalog # AAPH00280)
Key Reference:
Thiselton,D.L., et al., (2002) Genomics 79 (4), 560-572
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-RBM10 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question