website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

MYC antibody - N-terminal region (ARP32708_P050)

Description of Target:
MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.
Gene Symbol:
Official Gene Full Name:
V-myc myelocytomatosis viral oncogene homolog (avian)
NCBI Gene Id:
Alias Symbols:
c-Myc; MRTL; bHLHe39
Tissue Tool:
Find tissues and cell lines supported to express MYC.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Myc proto-oncogene protein
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-MYC antibody: synthetic peptide directed towards the N terminal of human MYC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
MYC antibody - N-terminal region (ARP32708_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Sheep: 93%; Horse: 86%; Bovine: 86%
Species Reactivity:
Human, Mouse, Pig, Guinea pig, Rat, Rabbit, Dog, Sheep, Horse, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-MYC antibody
- ARP32708_P050
Peptide Sequence:
Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ
Blocking Peptide:
For anti-MYC antibody is Catalog # AAP32708 (Previous Catalog # AAPP03722)
Target Reference:
Frater,J.L., (2006) Cancer Genet. Cytogenet. 166 (2), 139-145
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for MYC antibody (ARP32708)

Product page for MYC antibody (ARP32708)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Amazon dwarf squirrel c-myc antibody; Microsciurus flaviventer c-myc antibody Q6XD12 100%
Black giant squirrel c-myc antibody; Ratufa bicolor c-myc antibody Q6XD19 100%
Bornean orangutan MYC antibody; Pongo pygmaeus MYC antibody A2T7L5 100%
Bovine MYC antibody; Bos taurus MYC antibody Q2HJ27 85%
Brant climbing mouse c-myc antibody; Dendromus mesomelas c-myc antibody Q6XD27 92%
Brazilian free-tailed bat MYC antibody; Tadarida brasiliensis MYC antibody Q9MZT7 92%
Carruther mountain squirrel c-myc antibody; Funisciurus carruthersi c-myc antibody Q6XCZ5 100%
Cat MYC antibody; Felis catus MYC antibody P68271 92%
Cat MYC antibody; Felis catus MYC antibody D3U662 92%
Chimpanzee MYC antibody; Pan troglodytes MYC antibody P23583 100%
Common gibbon MYC antibody; Hylobates lar MYC antibody P49033 100%
Cottontail rabbit MYC antibody; Sylvilagus floridanus MYC antibody Q9MZT6 93%
Dog Cfa.3786 antibody; Canis familiaris Cfa.3786 antibody F1PW15 92%
Dog MYC antibody; Canis familiaris MYC antibody Q28350 92%
Domestic water buffalo cMyc antibody; Bubalus bubalis cMyc antibody G9JZK3 85%
Domestic water buffalo cMYC antibody; Bubalus bubalis cMYC antibody G3JXZ4 76%
Feline leukemia virus FTT MYC antibody P21438 92%
Feline leukemia virus MYC antibody P68272 92%
Feline leukemia virus v-myc antibody Q67004 92%
Giant panda MYC antibody; Ailuropoda melanoleuca MYC antibody G1M831 92%
Guinea pig MYC antibody; Cavia porcellus MYC antibody H0V0L5 100%
Horse LOC100068097 antibody; Equus caballus LOC100068097 antibody F6YAJ2 85%
Human c-myc antibody; Homo sapiens c-myc antibody Q16158 90%
Human MYC antibody; Homo sapiens MYC antibody P01106 100%
Human MYC antibody; Homo sapiens MYC antibody P01106-2 100%
Human MYC antibody; Homo sapiens MYC antibody H0YBT0 100%
Human MYC antibody; Homo sapiens MYC antibody H0YBG3 100%
Human MYC antibody; Homo sapiens MYC antibody B4E1N7 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJE0 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD9 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD8 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD7 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD3 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD2 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD1 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJC8 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJC7 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJC6 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJC0 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJB9 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJB8 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJB3 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJB2 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJB1 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJA4 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJA1 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ94 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ93 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ92 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ91 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ90 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ89 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ88 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ87 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ82 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ81 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ78 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ77 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ74 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ73 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ72 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ71 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ69 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ66 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ65 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ64 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJ63 100%
Human MYC antibody; Homo sapiens MYC antibody B0B0N9 100%
Human MYC antibody; Homo sapiens MYC antibody A0N2G3 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD6 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJD5 100%
Human MYC antibody; Homo sapiens MYC antibody B3CJA9 92%
Human MYC antibody; Homo sapiens MYC antibody B3CJA7 92%
Human MYC antibody; Homo sapiens MYC antibody B3CJ86 92%
Human MYC antibody; Homo sapiens MYC antibody B3CJA3 92%
Human MYC antibody; Homo sapiens MYC antibody B3CJB0 92%
Human MYC antibody; Homo sapiens MYC antibody B3CJ76 92%
Human MYC antibody; Homo sapiens MYC antibody B3CJ75 92%
Human MYC antibody; Homo sapiens MYC antibody B3CJA8 78%
Island flying fox MYC antibody; Pteropus hypomelanus MYC antibody Q9MZT8 85%
Little brown bat MYC antibody; Myotis lucifugus MYC antibody G1QCG9 92%
Lowland gorilla ENSG00000136997 antibody; Gorilla gorilla gorilla ENSG00000136997 antibody G3RS08 100%
Lowland gorilla ENSG00000136997 antibody; Gorilla gorilla gorilla ENSG00000136997 antibody G3R8W6 100%
Luzon hairy-tailed rat c-myc antibody; Batomys granti c-myc antibody Q6XD25 92%
Malayan flying lemur MYC antibody; Galeopterus variegatus MYC antibody Q9MZU0 78%
Meadow vole c-myc antibody; Microtus pennsylvanicus c-myc antibody Q6XD24 92%
Mouse MYC antibody; Mus musculus MYC antibody P01108 100%
Mouse Myc antibody; Mus musculus Myc antibody Q9Z197 100%
Mouse Myc antibody; Mus musculus Myc antibody F8WID3 100%
Mouse Myc antibody; Mus musculus Myc antibody F6PX41 100%
Mouse Myc antibody; Mus musculus Myc antibody E0CZD1 100%
Mouse Myc antibody; Mus musculus Myc antibody B2RSN1 100%
Neotropical pygmy squirrel c-myc antibody; Sciurillus pusillus c-myc antibody Q6XD17 100%
Northern white-cheeked gibbon MYC antibody; Nomascus leucogenys MYC antibody G1R0L9 100%
Perny long-nosed squirrel c-myc antibody; Dremomys pernyi c-myc antibody Q6XD08 100%
Philippine pygmy squirrel c-myc antibody; Exilisciurus concinnus c-myc antibody Q6XD06 100%
Phyllotis xanthopygus chilensis c-myc antibody arget='_blank'>Q6XD22 100%
Pig MYC antibody; Sus scrofa MYC antibody Q29031 100%
Pig MYC antibody; Sus scrofa MYC antibody F1RRR8 100%
Pygmy chimpanzee MYC antibody; Pan paniscus MYC antibody A1YG22 100%
Rabbit c-myc antibody; Oryctolagus cuniculus c-myc antibody Q9MYT4 100%
Rat MYC antibody; Rattus norvegicus MYC antibody P09416 92%
Rat Myc antibody; Rattus norvegicus Myc antibody F8WFG7 92%
Ratufa sp. LSUMZ M3476 c-myc antibody Q6XD18 100%
Rhesus macaque MYC antibody; Macaca mulatta MYC antibody B8XIA5 100%
Rhesus macaque MYC antibody; Macaca mulatta MYC antibody G7N040 100%
Rhesus macaque MYC antibody; Macaca mulatta MYC antibody A2D666 100%
Ruwenzori sun squirrel c-myc antibody; Heliosciurus ruwenzorii c-myc antibody Q6XCZ8 100%
Sheep MYC antibody; Ovis aries MYC antibody Q28566 92%
Small-eared galago MYC antibody; Otolemur garnettii MYC antibody H0WRX5 85%
Smith bush squirrel c-myc antibody; Paraxerus cepapi c-myc antibody Q6XCZ4 100%
Southern flying squirrel c-myc antibody; Glaucomys volans c-myc antibody Q6XD16 100%
Tree shrew MYC antibody; Tupaia glis MYC antibody Q9MZT9 85%
Unstriped ground squirrel c-myc antibody; Xerus rutilus c-myc antibody Q6XD04 100%
western gorilla MYC antibody; Gorilla gorilla MYC antibody A1YEV4 100%
White-tufted-ear marmoset LOC100407754 antibody; Callithrix jacchus LOC100407754 antibody F7IB97 92%
White-tufted-ear marmoset LOC100407754 antibody; Callithrix jacchus LOC100407754 antibody F7I481 92%
White-tufted-ear marmoset MYC antibody; Callithrix jacchus MYC antibody P49032 92%
Woodchuck MYC antibody; Marmota monax MYC antibody P22555 92%

Product Protocols: MYC antibody tested with Human Transfected 293T Cells (ARP32708_P050)

Aviva Systems Biology is the original manufacturer of this MYC antibody (ARP32708_P050)

Click here to view the MYC antibody Western Blot Protocol

Product Datasheet Link: MYC antibody (ARP32708_P050)

WB Suggested Anti-MYC Antibody Titration: 0.0625ug/ml
Positive Control: Transfected 293T

Western Blot image:

Description of Target: MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s MYC antibody (ARP32708_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: MYC antibody tested by IHC with human muscle (ARP32708)

Aviva Systems Biology is the original manufacturer of this MYC antibody.

Click here to view the MYC antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: MYC antibody (ARP32708)

IHC Information:

Rabbit Anti-MYC Antibody
Catalog Number: ARP32708
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question