website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

MYC antibody - N-terminal region (ARP32708_P050)

Description of Target:
MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.
Gene Symbol:
Official Gene Full Name:
V-myc myelocytomatosis viral oncogene homolog (avian)
NCBI Gene Id:
Alias Symbols:
c-Myc; MRTL; bHLHe39
Tissue Tool:
Find tissues and cell lines supported to express MYC.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Myc proto-oncogene protein
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-MYC antibody: synthetic peptide directed towards the N terminal of human MYC
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
MYC antibody - N-terminal region (ARP32708_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Sheep: 93%; Horse: 86%; Bovine: 86%
Species Reactivity:
Human, Mouse, Pig, Guinea pig, Rat, Rabbit, Dog, Sheep, Horse, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-MYC antibody
- ARP32708_P050
Peptide Sequence:
Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ
Blocking Peptide:
For anti-MYC antibody is Catalog # AAP32708 (Previous Catalog # AAPP03722)
Key Reference:
Frater,J.L., (2006) Cancer Genet. Cytogenet. 166 (2), 139-145
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MYC antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question