website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

GFI1B antibody - N-terminal region (ARP30093_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.
Gene Symbol:
Official Gene Full Name:
Growth factor independent 1B transcription repressor
NCBI Gene Id:
Tissue Tool:
Find tissues and cell lines supported to express GFI1B.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Zinc finger protein Gfi-1b
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-GFI1B antibody: synthetic peptide directed towards the N terminal of human GFI1B
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
GFI1B antibody - N-terminal region (ARP30093_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Goat: 83%; Mouse: 83%; Bovine: 83%; Rat: 82%
Species Reactivity:
Dog, Horse, Human, Pig, Mouse, Goat, Bovine, Rat
Datasheets / Downloads:
Printable datasheet for
anti-GFI1B antibody
- ARP30093_P050
Peptide Sequence:
Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Blocking Peptide:
For anti-GFI1B antibody is Catalog # AAP30093 (Previous Catalog # AAPH00269)
Target Reference:
Huang,D.Y., et al., (2004) Nucleic Acids Res. 32 (13), 3935-3946
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for GFI1B antibody (ARP30093)

Product page for GFI1B antibody (ARP30093)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant GFI1B antibody; Loxodonta africana GFI1B antibody G3U954 100%
African elephant LOC100666345 antibody; Loxodonta africana LOC100666345 antibody G3TQT5 100%
Bovine GFI1B antibody; Bos taurus GFI1B antibody Q5MAB9 83%
Dog GFI1B antibody; Canis familiaris GFI1B antibody E2R914 100%
Dog GFI1B antibody; Canis familiaris GFI1B antibody E2QYK0 100%
Giant panda LOC100469870 antibody; Ailuropoda melanoleuca LOC100469870 antibody D2HPM6 84%
Horse GFI1B antibody; Equus caballus GFI1B antibody F6UVS7 100%
Human GFI1B antibody; Homo sapiens GFI1B antibody Q5VTD9 100%
Human GFI1B antibody; Homo sapiens GFI1B antibody Q5VTD9-2 100%
Little brown bat GFI1B antibody; Myotis lucifugus GFI1B antibody G1P7I9 92%
Lowland gorilla GFI1B antibody; Gorilla gorilla gorilla GFI1B antibody G3RID7 100%
Mouse GFI1B antibody; Mus musculus GFI1B antibody O70237 83%
Mouse Gfi1b antibody; Mus musculus Gfi1b antibody B7ZNH2 83%
Northern white-cheeked gibbon GFI1B antibody; Nomascus leucogenys GFI1B antibody G1RR70 92%
Pig GFI1B antibody; Sus scrofa GFI1B antibody F1S0S2 92%
Rat Gfi1b antibody; Rattus norvegicus Gfi1b antibody D3ZHB6 75%
Rat Gfi1b antibody; Rattus norvegicus Gfi1b antibody B0BN50 75%
Rhesus macaque GFI1B antibody; Macaca mulatta GFI1B antibody F7C4R5 100%
Rhesus macaque GFI1B antibody; Macaca mulatta GFI1B antibody F6UVT1 100%
Small-eared galago GFI1B antibody; Otolemur garnettii GFI1B antibody H0WZE6 100%
White-tufted-ear marmoset GFI1B antibody; Callithrix jacchus GFI1B antibody F7AET1 92%
White-tufted-ear marmoset GFI1B antibody; Callithrix jacchus GFI1B antibody F6RY89 92%

Product Protocols: GFI1B antibody tested with Human Jurkat Cells (ARP30093_P050)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody (ARP30093_P050)

Click here to view the GFI1B antibody Western Blot Protocol

Product Datasheet Link: GFI1B antibody (ARP30093_P050)

WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GFI1B antibody (ARP30093_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: GFI1B antibody tested by IHC with human kidney (ARP30093)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody.

Click here to view the GFI1B antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GFI1B antibody (ARP30093)

IHC Information:

Rabbit Anti-GFI1B Antibody
Catalog Number: ARP30093
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule and renal corpuscle
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: GFI1B antibody tested by IHC with human heart (ARP30093)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody.

Click here to view the GFI1B antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GFI1B antibody (ARP30093)

IHC Information:

Rabbit Anti-GFI1B Antibody
Catalog Number: ARP30093
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question