website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

GFI1B antibody - N-terminal region (ARP30093_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.
Gene Symbol:
Official Gene Full Name:
Growth factor independent 1B transcription repressor
NCBI Gene Id:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GFI1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GFI1B.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Zinc finger protein Gfi-1b
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the N terminal region of human GFI1B
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-GFI1B (ARP30093_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 83%; Dog: 100%; Goat: 83%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 93%; Rat: 82%
Species Reactivity:
Cow; Dog; Goat; Horse; Human; Mouse; Pig; Rat
Datasheets / Downloads:
Printable datasheet for anti-GFI1B (ARP30093_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Blocking Peptide:
For anti-GFI1B (ARP30093_P050) antibody is Catalog # AAP30093 (Previous Catalog # AAPH00269)
Target Reference:
Huang,D.Y., et al., (2004) Nucleic Acids Res. 32 (13), 3935-3946
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: GFI1B antibody tested with Human Jurkat Cells (ARP30093_P050)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody (ARP30093_P050)

Click here to view the GFI1B antibody Western Blot Protocol

Product Datasheet Link: GFI1B antibody (ARP30093_P050)

WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat

Western Blot image:

Description of Target: GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GFI1B antibody (ARP30093_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: GFI1B antibody tested by IHC with human kidney (ARP30093)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody.

Click here to view the GFI1B antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GFI1B antibody (ARP30093)

IHC Information:

Rabbit Anti-GFI1B Antibody
Catalog Number: ARP30093
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule and renal corpuscle
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: GFI1B antibody tested by IHC with human heart (ARP30093)

Aviva Systems Biology is the original manufacturer of this GFI1B antibody.

Click here to view the GFI1B antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GFI1B antibody (ARP30093)

IHC Information:

Rabbit Anti-GFI1B Antibody
Catalog Number: ARP30093
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question