website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

GFI1B antibody - N-terminal region (ARP30093_P050)

Receive a free positive control (AHL002) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.
Gene Symbol:
GFI1B
Official Gene Full Name:
Growth factor independent 1B transcription repressor
NCBI Gene Id:
8328
Tissue Tool:
Find tissues and cell lines supported to express GFI1B.
Protein Accession #:
NP_004179
Nucleotide Accession#:
NM_004188
Swissprot Id:
Q6T888
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Zinc finger protein Gfi-1b
Protein Size (# AA):
330
Molecular Weight:
38kDa
Application:
IHC, WB
Immunogen:
The immunogen for anti-GFI1B antibody: synthetic peptide directed towards the N terminal of human GFI1B
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
GFI1B antibody - N-terminal region (ARP30093_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Goat: 83%; Mouse: 83%; Bovine: 83%; Rat: 82%
Species Reactivity:
Dog, Horse, Human, Pig, Mouse, Goat, Bovine, Rat
Datasheets / Downloads:
Printable datasheet for
anti-GFI1B antibody
- ARP30093_P050
Peptide Sequence:
Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Blocking Peptide:
For anti-GFI1B antibody is Catalog # AAP30093 (Previous Catalog # AAPH00269)
Key Reference:
Huang,D.Y., et al., (2004) Nucleic Acids Res. 32 (13), 3935-3946
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-GFI1B antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question