website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

TP53 antibody - N-terminal region (ARP30312_P050)

Description of Target:
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Gene Symbol:
NCBI Gene Id:
Alias Symbols:
LFS1; TRP53; p53
Sample Type Confirmation:

TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Tissue Tool:
Find tissues and cell lines supported to express TP53.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Cellular tumor antigen p53
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
TP53 antibody - N-terminal region (ARP30312_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-TP53 antibody
- ARP30312_P050
Peptide Sequence:
Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
Blocking Peptide:
For anti-TP53 antibody is Catalog # AAP30312 (Previous Catalog # AAPS08802)
Target Reference:
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Customer Reviews for TP53 Antibody (ARP30312_P050) tested with U20S, PLKO cells in Chromatin Immunoprecipitation

-submitted by Nick Barlev
University of Leicester

U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Product Review: TP53 antibody - N-terminal region (ARP30312_P050) for human cystic fibrosis bronchial epithelial cells for western blot

Product Review: TP53 antibody - N-terminal region (ARP30312_P050) for human cystic fibrosis bronchial epithelial cells for western blot
TP53 antibody - N-terminal region (ARP30312_P050) for western blot
TP53 antibody - N-terminal region (ARP30312_P050) for human cystic fibrosis bronchial epithelial cells

The P53 worked very well.
P53: 1/1 000
Goat anti-rabbit-HRP: 1:5000

Data submitted by: Dr. Haouaria Balghi, McGill University

Computational species homology for TP53 antibody (ARP30312)

Product page for TP53 antibody (ARP30312)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Common tree shrew P53 antibody; Tupaia belangeri P53 antibody Q9TTA1 100%
Human P53 antibody; Homo sapiens P53 antibody P04637 100%
Human P53 antibody; Homo sapiens P53 antibody P04637-6 100%
Human P53 antibody; Homo sapiens P53 antibody P04637-5 100%
Human P53 antibody; Homo sapiens P53 antibody P04637-4 100%
Human P53 antibody; Homo sapiens P53 antibody P04637-3 100%
Human P53 antibody; Homo sapiens P53 antibody P04637-2 100%
Human p53 antibody; Homo sapiens p53 antibody G4Y083 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q2XSC7 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q1MSX0 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q1MSW9 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q1MSW8 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q0PKT5 100%
Human TP53 antibody; Homo sapiens TP53 antibody E9PCY9 100%
Human TP53 antibody; Homo sapiens TP53 antibody E7EQX7 100%
Human TP53 antibody; Homo sapiens TP53 antibody E7EMR6 100%
Human TP53 antibody; Homo sapiens TP53 antibody E5RMA8 100%
Human TP53 antibody; Homo sapiens TP53 antibody D5KL90 100%
Human TP53 antibody; Homo sapiens TP53 antibody A2I9Y7 100%
Lowland gorilla ENSG00000141510 antibody; Gorilla gorilla gorilla ENSG00000141510 antibody G3R2U9 100%

Product Protocols: TP53 antibody tested with Human 293T Cells (ARP30312_P050)

Aviva Systems Biology is the original manufacturer of this TP53 antibody (ARP30312_P050)

Click here to view the TP53 antibody Western Blot Protocol

Product Datasheet Link: TP53 antibody (ARP30312_P050)

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T

Western Blot image:

Description of Target: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TP53 antibody (ARP30312_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: TP53 antibody – N-terminal region (ARP30312_P050) in PLKO AND U2OS cells using ChIp Assays

Product Page Link: TP53 antibody - N-terminal region (ARP30312_P050)

Data provided by: Dr. Barlev, University of Leicester

Figure 1. Binding of p53-specific antibodies to the p21 promoter. U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Ask a Question