TP53 antibody - N-terminal region (ARP30312_P050)

Catalog#: ARP30312_P050

• Size: 50ug

Human 293T

Human Bronchial Epithelial

Human U2OS, PLKO

• Description of Target: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
• Gene Symbol: TP53
• Alias Symbols: LFS1; TRP53; p53
• Protein Accession#: NP_000537
• Nucleotide Accession#: NM_000546
• Swissprot Id: P04637
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 393
• Molecular Weight: 44kDa
• Application: WB, CHIP
• Partner Proteins: AKT1, CARD11, PKN2, PRKCD, PRKCQ, PRKCZ, AKT1, AKT2, AKT3, AKTIP, CARD11, CDAN1, HSP90AA1, ILK, IRS1, ITGB3, MTOR, PAK1, PDPK1, PKN1, PKN2, PRKACA, PRKCB, PRKCD, PRKCE, PRKCI, PRKCZ, PRSS23, PTK2B, PXN, RALGDS, RPS6KA1, RPS6KA3, RPS6KB1, RPS6KB2, SGK1, SGK2, SGK3, SLC9A3R2, SRC, STRAP, YWHAH, YWH
• Immunogen: The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
• Blocking Peptide: For anti-TP53 antibody is Catalog # AAP30312 (Previous Catalog # AAPS08802)
• Key Reference: Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-TP53 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Customer Reviews for TP53 Antibody (ARP30312_P050) tested with U20S, PLKO cells in Chromatin Immunoprecipitation

CAT#ARP30312
-submitted by Nick Barlev
University of Leicester

U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Product Review: TP53 antibody - N-terminal region (ARP30312_P050) for human cystic fibrosis bronchial epithelial cells for western blot

Product Review: TP53 antibody - N-terminal region (ARP30312_P050) for human cystic fibrosis bronchial epithelial cells for western blot
TP53 antibody - N-terminal region (ARP30312_P050) for western blot
TP53 antibody - N-terminal region (ARP30312_P050) for human cystic fibrosis bronchial epithelial cells

The P53 worked very well.
P53: 1/1 000
Goat anti-rabbit-HRP: 1:5000

Data submitted by: Dr. Haouaria Balghi, McGill University

Product Protocols: TP53 antibody tested with Human 293T Cells (ARP30312_P050)

Aviva Systems Biology is the original manufacturer of this TP53 antibody (ARP30312_P050)

Click here to view the TP53 antibody Western Blot Protocol

Product Datasheet Link: TP53 antibody (ARP30312_P050)

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T

Western Blot image:


Description of Target: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TP53 antibody (ARP30312_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: TP53 antibody – N-terminal region (ARP30312_P050) in PLKO AND U2OS cells using ChIp Assays

Product Page Link: TP53 antibody - N-terminal region (ARP30312_P050)

Data provided by: Dr. Barlev, University of Leicester

Figure 1. Binding of p53-specific antibodies to the p21 promoter. U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).