website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$220.00
In Stock

Recombinant human L-lactate dehydrogenase B chain (OPCA00385)

Description of Target:
Recombinant human L-lactate dehydrogenase B chain
Gene Symbol:
LDHB
NCBI Gene Id:
3945
Alias Symbols:
LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281;
Protein Name:
L-lactate dehydrogenase B chain
Purity:
>90% (SDS-PAGE)
Source:
E.coli
Peptide Sequence:
ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Additional Information:
Tag information : His tag
Reconstitution and Storage:
Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Datasheets / Downloads:
Printable datasheet for
Recombinant human L-lactate dehydrogenase B chain (OPCA00385)
OPCA00385
 
X
Ask a Question