- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
RDHE2 Antibody - middle region (ARP52667_P050)
| Datasheets/Manuals | Printable datasheet for anti-SDR16C5 (ARP52667_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Rat, Guinea Pig |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RDHE2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Guinea Pig: 92%; Human: 100%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SDR16C5 (ARP52667_P050) antibody is Catalog # AAP52667 (Previous Catalog # AAPY03747) |
| Reference | Matsuzaka,Y., (2004) Mamm. Genome 15 (8), 668-675 |
| Gene Symbol | SDR16C5 |
|---|---|
| Gene Full Name | Short chain dehydrogenase/reductase family 16C, member 5 |
| Alias Symbols | RDH#2, RDHE2, EPHD-2, RDH-E2, retSDR2 |
| NCBI Gene Id | 195814 |
| Protein Name | Epidermal retinol dehydrogenase 2 |
| Description of Target | The specific function of RDHE2 is not yet known.RDHE2 belongs to a family of short-chain alcohol dehydrogenases/reductases that catalyze the first and rate-limiting step that generates retinaldehyde from retinol (Matsuzaka et al., 2002 [PubMed 12372410]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-454 AB083038.1 1-454 455-1307 AK095159.1 549-1401 1308-2860 BC037219.1 749-2301 2861-3039 BC037219.1 2303-2481 |
| Uniprot ID | Q8N3Y7 |
| Protein Accession # | NP_620419 |
| Nucleotide Accession # | NM_138969 |
| Protein Size (# AA) | 309 |
| Molecular Weight | 34kDa |
| Protein Interactions | NLK; UBC; EXTL1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RDHE2 Antibody - middle region (ARP52667_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Guinea Pig".
-
How long will it take to receive "RDHE2 Antibody - middle region (ARP52667_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "RDHE2 Antibody - middle region (ARP52667_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RDHE2 Antibody - middle region (ARP52667_P050)"?
This target may also be called "RDH#2, RDHE2, EPHD-2, RDH-E2, retSDR2" in publications.
-
What is the shipping cost for "RDHE2 Antibody - middle region (ARP52667_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RDHE2 Antibody - middle region (ARP52667_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RDHE2 Antibody - middle region (ARP52667_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "34kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RDHE2 Antibody - middle region (ARP52667_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SDR16C5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SDR16C5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SDR16C5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SDR16C5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SDR16C5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SDR16C5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.