website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

RBBP9 Antibody (ARP34703_P050)

Description of Target:
RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Gene Symbol:
RBBP9
Official Gene Full Name:
Retinoblastoma binding protein 9
NCBI Gene Id:
10741
Alias Symbols:
BOG; MGC9236; RBBP10
Tissue Tool:
Find tissues and cell lines supported to express RBBP9.
Protein Accession #:
NP_006597
Nucleotide Accession#:
NM_006606
Swissprot Id:
O75884
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Putative hydrolase RBBP9
Protein Size (# AA):
186
Molecular Weight:
21kDa
Application:
IF, WB
Partner Proteins:
BMPR1A, C11orf30, DYNLL1, ETS2, NCOR1, SMAD2, TRAF6, BMPR1A, C11orf30, E2F6, EP400, ETS2, EZH1, EZH2, HDAC1, MYB, NCOR1, PDLIM7, SMARCA2, TAB1, TP53, TRAF6, ZHX1
Immunogen:
The immunogen for anti-RBBP9 antibody: synthetic peptide directed towards the N terminal of human RBBP9
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
RBBP9 Antibody (ARP34703_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 91%; Bovine: 79%
Species Reactivity:
Human, Mouse, Dog, Pig, Horse, Rabbit, Rat, Guinea pig, Zebrafish, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-RBBP9 antibody
- Printable datasheet for
anti-RBBP9 antibody
- ARP34703_P050
Peptide Sequence:
Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
Blocking Peptide:
For anti-RBBP9 antibody is For anti-RBBP9 antibody is Catalog # AAP34703 (Previous Catalog # AAPP23651)
Target Reference:
Chen,J., (2003) J. Hum. Genet. 48 (4), 164-169
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-RBBP9 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Customer Reviews for RBBP9 Antibody (ARP34703_P050) tested with corneal endothelium in Immunofluorescence

 CAT# ARP34703_P050 RBBP9

RBBP9 Antibody

RBBP9 Antibody Immunofluorescence

RBBP9 Antibody Corneal Epithelium, Corneal Endothelium, and Limbus

Submitted By: Laboratory of Biology & Pathology Institute of the Eye, Charles University in Prague

Samples
Cryosections: - control corneal buttons were dissected, snap frozen in liquid nitrogen, embedded in Optimal Cutting Temperature Compound and stored at 70°C. Tissue slices 7μm thick were cut as cryosections.

Method: Indirect immunofluorescence
Cryosections
Three cryosections on each slide were stained with a single antibody. The fourth slice was used as a negative control (primary antibody omitted). The tissue was fixed with cold acetone for 10 minutes, rinsed in phosphate buffered saline (PBS) and incubated with the primary antibody diluted in 1% bovine serum albumin (BSA) in PBS for 1 hour at room temperature.
Rabbit anti human antibodies and dilutions used:
f) RBBP9, most suitable concentration 1:150

Then the specimens were washed three times in PBS and incubated with the secondary antibody (fluorescein isothiocyanate-conjugated anti-rabbit IgG, 1:300, Jackson ImmunoResearch Laboratories, West Grove, USA) for 1 hour at room temperature. After rinsing in PBS the slices were mounted with Vectashield-propidium iodide (Vector Laboratories, Inc. Burlingame, USA) to counterstain nuclear DNA.

RBBP9 - corneal endothelium, epithelium as well as limbal epithelium and stromal keratocytes were positive (strong intracytoplasmic positivity – “dots” within cell cytoplasm, weaker signal in the nucleus).

Computational species homology for RBBP9 antibody (ARP34703)

Product page for RBBP9 antibody (ARP34703)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog rbbp9 antibody; Xenopus laevis rbbp9 antibody Q0P3R1 83%
African elephant LOC100672046 antibody; Loxodonta africana LOC100672046 antibody G3SNA6 92%
Atlantic salmon rbbp9 antibody; Salmo salar rbbp9 antibody B5XBC8 83%
Bovine BT.32989 antibody; Bos taurus BT.32989 antibody F1MS64 78%
Bovine RBBP9 antibody; Bos taurus RBBP9 antibody A4FV34 78%
Chinese hamster LOC100766553 antibody; Cricetulus griseus LOC100766553 antibody G3GVW2 92%
Dog Cfa.43360 antibody; Canis familiaris Cfa.43360 antibody E2RH01 92%
Dog Cfa.43360 antibody; Canis familiaris Cfa.43360 antibody E2R7S8 92%
Giant panda LOC100471291 antibody; Ailuropoda melanoleuca LOC100471291 antibody D2HSX4 92%
Gray short-tailed opossum LOC100033254 antibody; Monodelphis domestica LOC100033254 antibody F7BWC2 92%
Guinea pig LOC100722474 antibody; Cavia porcellus LOC100722474 antibody H0UYH3 92%
Horse LOC100050518 antibody; Equus caballus LOC100050518 antibody F6U6W8 92%
Human RBBP9 antibody; Homo sapiens RBBP9 antibody O75884 100%
Human RBBP9 antibody; Homo sapiens RBBP9 antibody O75884-2 100%
Human RBBP9 antibody; Homo sapiens RBBP9 antibody C9JHF3 100%
Lowland gorilla RBBP9 antibody; Gorilla gorilla gorilla RBBP9 antibody G3QZ26 100%
Mouse RBBP9 antibody; Mus musculus RBBP9 antibody O88851 92%
Mouse Rbbp9 antibody; Mus musculus Rbbp9 antibody Q80YU9 92%
Mouse Rbbp9 antibody; Mus musculus Rbbp9 antibody A2AN96 92%
Northern white-cheeked gibbon LOC100585619 antibody; Nomascus leucogenys LOC100585619 antibody G1RFD0 100%
Pig LOC100738866 antibody; Sus scrofa LOC100738866 antibody F1SBH3 92%
Rabbit LOC100346098 antibody; Oryctolagus cuniculus LOC100346098 antibody G1T8N7 92%
Rainbow smelt RBBP9 antibody; Osmerus mordax RBBP9 antibody C1BLZ2 91%
Rat RBBP9 antibody; Rattus norvegicus RBBP9 antibody O88350 92%
Rhesus macaque RBBP9 antibody; Macaca mulatta RBBP9 antibody F6XKW1 100%
Rhesus macaque RBBP9 antibody; Macaca mulatta RBBP9 antibody F6XKM4 100%
Small-eared galago RBBP9 antibody; Otolemur garnettii RBBP9 antibody H0WLQ9 92%
Western Mediterranean mouse Rbbp9 antibody; Mus spretus Rbbp9 antibody A8QKA9 92%
White-tufted-ear marmoset LOC100414631 antibody; Callithrix jacchus LOC100414631 antibody F7GC53 92%
White-tufted-ear marmoset LOC100414631 antibody; Callithrix jacchus LOC100414631 antibody F7GC35 92%

Product Protocols: RBBP9 antibody tested with Human Thp-1 Cells (ARP34703_P050)

Aviva Systems Biology is the original manufacturer of this RBBP9 antibody (ARP34703_P050)

Click here to view the RBBP9 antibody Western Blot Protocol

Product Datasheet Link: RBBP9 antibody (ARP34703_P050)

WB Suggested Anti-RBBP9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1

Western Blot image:


Description of Target: RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RBBP9 antibody (ARP34703_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question