website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

RBBP9 Antibody (ARP34703_P050)

Description of Target:
RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Gene Symbol:
RBBP9
Official Gene Full Name:
Retinoblastoma binding protein 9
NCBI Gene Id:
10741
Alias Symbols:
BOG; MGC9236; RBBP10
Tissue Tool:
Find tissues and cell lines supported to express RBBP9.
Protein Accession #:
NP_006597
Nucleotide Accession#:
NM_006606
Swissprot Id:
O75884
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Putative hydrolase RBBP9
Protein Size (# AA):
186
Molecular Weight:
21kDa
Application:
IF, WB
Partner Proteins:
BMPR1A, C11orf30, DYNLL1, ETS2, NCOR1, SMAD2, TRAF6, BMPR1A, C11orf30, E2F6, EP400, ETS2, EZH1, EZH2, HDAC1, MYB, NCOR1, PDLIM7, SMARCA2, TAB1, TP53, TRAF6, ZHX1
Immunogen:
The immunogen for anti-RBBP9 antibody: synthetic peptide directed towards the N terminal of human RBBP9
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
RBBP9 Antibody (ARP34703_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 91%; Bovine: 79%
Species Reactivity:
Human, Mouse, Dog, Pig, Horse, Rabbit, Rat, Guinea pig, Zebrafish, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-RBBP9 antibody
- Printable datasheet for
anti-RBBP9 antibody
- ARP34703_P050
Peptide Sequence:
Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
Blocking Peptide:
For anti-RBBP9 antibody is For anti-RBBP9 antibody is Catalog # AAP34703 (Previous Catalog # AAPP23651)
Key Reference:
Chen,J., (2003) J. Hum. Genet. 48 (4), 164-169
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-RBBP9 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question