website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RBBP9 Antibody (ARP34703_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP34703_P050-FITC Conjugated

ARP34703_P050-HRP Conjugated

ARP34703_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Retinoblastoma binding protein 9
Protein Name:
Putative hydrolase RBBP9
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BOG, MGC9236, RBBP10
Replacement Item:
This antibody may replace item sc-101111 from Santa Cruz Biotechnology.
Description of Target:
RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBBP9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBBP9.
The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP9
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 91%
Complete computational species homology data:
Anti-RBBP9 (ARP34703_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RBBP9 (ARP34703_P050) antibody is Catalog # AAP34703 (Previous Catalog # AAPP23651)
Datasheets / Downloads:
Printable datasheet for anti-RBBP9 (ARP34703_P050) antibody
Target Reference:
Chen,J., (2003) J. Hum. Genet. 48 (4), 164-169

Customer Reviews for RBBP9 Antibody (ARP34703_P050) tested with corneal endothelium in Immunofluorescence

 CAT# ARP34703_P050 RBBP9

RBBP9 Antibody

RBBP9 Antibody Immunofluorescence

RBBP9 Antibody Corneal Epithelium, Corneal Endothelium, and Limbus

Submitted By: Laboratory of Biology & Pathology Institute of the Eye, Charles University in Prague

Cryosections: - control corneal buttons were dissected, snap frozen in liquid nitrogen, embedded in Optimal Cutting Temperature Compound and stored at 70°C. Tissue slices 7μm thick were cut as cryosections.

Method: Indirect immunofluorescence
Three cryosections on each slide were stained with a single antibody. The fourth slice was used as a negative control (primary antibody omitted). The tissue was fixed with cold acetone for 10 minutes, rinsed in phosphate buffered saline (PBS) and incubated with the primary antibody diluted in 1% bovine serum albumin (BSA) in PBS for 1 hour at room temperature.
Rabbit anti human antibodies and dilutions used:
f) RBBP9, most suitable concentration 1:150

Then the specimens were washed three times in PBS and incubated with the secondary antibody (fluorescein isothiocyanate-conjugated anti-rabbit IgG, 1:300, Jackson ImmunoResearch Laboratories, West Grove, USA) for 1 hour at room temperature. After rinsing in PBS the slices were mounted with Vectashield-propidium iodide (Vector Laboratories, Inc. Burlingame, USA) to counterstain nuclear DNA.

RBBP9 - corneal endothelium, epithelium as well as limbal epithelium and stromal keratocytes were positive (strong intracytoplasmic positivity – “dots” within cell cytoplasm, weaker signal in the nucleus).

Product Protocols: RBBP9 antibody tested with Human Thp-1 Cells (ARP34703_P050)

Aviva Systems Biology is the original manufacturer of this RBBP9 antibody (ARP34703_P050)

Click here to view the RBBP9 antibody Western Blot Protocol

Product Datasheet Link: RBBP9 antibody (ARP34703_P050)

WB Suggested Anti-RBBP9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1

Western Blot image:

Description of Target: RBBP9 may play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1.The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s RBBP9 antibody (ARP34703_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...