- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for RANTES Antibody (OABB02056) |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Western blot |
Additional Information | Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: Chemokine (C-C motif) ligand 5 (also CCL5) is a protein which in humans is encoded by the CCL5 gene. It is also known as RANTES. This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | E. coli-derived human RANTES recombinant protein (Position: Y26-S91). Human RANTES shares 83.3% amino acid (aa) sequence identity with both mouse and rat RANTES. |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: YSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human ELISA : 0.1-0.5 ug/ml: Human |
Reference | 1. Donlon TA, Krensky AM, Wallace MR, Collins FS, Lovett M, Clayberger C (March 1990). "Localization of a human T-cell-specific gene, RANTES (D17S136E), to chromosome 17q11.2-q12". Genomics 6 (3): 548–53. 2. Maghazachi AA, Al-Aoukaty A, Schall TJ (February 1996). "CC chemokines induce the generation of killer cells from CD56+ cells". Eur. J. Immunol. 26 (2): 315–9. 3. Song A, Nikolcheva T, Krensky AM (October 2000). "Transcriptional regulation of RANTES expression in T lymphocytes". Immunol. Rev. 177: 236–45. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for C-C motif chemokine 5(CCL5) detection. Tested with WB, ELISA in Human. |
Gene Symbol | CCL5 |
---|---|
Gene Full Name | C-C motif chemokine ligand 5 |
Alias Symbols | beta-chemokine RANTES;C-C motif chemokine 5;chemokine (C-C motif) ligand 5;D17S136E;eoCP;eosinophil chemotactic cytokine;RANTES;regulated upon activation, normally T-expressed, and presumably secreted;SCYA5;SISd;SIS-delta;small inducible cytokine subfamily A (Cys-Cys), member 5;Small-inducible cytokine A5;T cell-specific protein P228;T-cell specific protein p288;T-cell-specific protein RANTES;TCP228. |
NCBI Gene Id | 6352 |
Protein Name | C-C motif chemokine 5 |
Description of Target | Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils (PubMed:16791620, PubMed:1380064, PubMed:8525373, PubMed:9516414, PubMed:15923218). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485). |
Uniprot ID | P13501 |
Molecular Weight | 9990 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RANTES Antibody (OABB02056)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "RANTES Antibody (OABB02056)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "RANTES Antibody (OABB02056)" provided in?
This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RANTES Antibody (OABB02056)"?
This target may also be called "beta-chemokine RANTES;C-C motif chemokine 5;chemokine (C-C motif) ligand 5;D17S136E;eoCP;eosinophil chemotactic cytokine;RANTES;regulated upon activation, normally T-expressed, and presumably secreted;SCYA5;SISd;SIS-delta;small inducible cytokine subfamily A (Cys-Cys), member 5;Small-inducible cytokine A5;T cell-specific protein P228;T-cell specific protein p288;T-cell-specific protein RANTES;TCP228." in publications.
-
What is the shipping cost for "RANTES Antibody (OABB02056)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RANTES Antibody (OABB02056)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RANTES Antibody (OABB02056)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "9990 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RANTES Antibody (OABB02056)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CCL5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CCL5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CCL5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CCL5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CCL5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CCL5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.