RAGE Antibody - N-terminal region (ARP56743_P050)

Catalog No: ARP56743_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-RAGE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAGE
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MOK (ARP56743_P050) antibody is Catalog # AAP56743 (Previous Catalog # AAPP39601)
• Reference: Luo,H.R., (2001) Neuron 31 (3), 439-451
• Publications:

  Tafani, M. et al. Hypoxia-increased RAGE and P2X7R expression regulates tumor cell invasion through phosphorylation of Erk1/2 and Akt and nuclear translocation of NF-{kappa}B. Carcinogenesis 32, 1167-75 (2011). 21642357

Target Info

• Gene Symbol: MOK
• Gene Full Name: MOK protein kinase
• Alias Symbols: RAGE, RAGE1, STK30, RAGE-1
• NCBI Gene Id: 5891
• Protein Name: MAPK/MAK/MRK overlapping kinase
• Description of Target: RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
• Uniprot ID: Q9UQ07
• Protein Accession #: NP_055041
• Nucleotide Accession #: NM_013401
• Protein Size (# AA): 419
• Molecular Weight: 48kDa
• Protein Interactions: UBC; WDR18; SDF4; HUWE1; ZNF223; MOK; INSR; MAPK6; MYC; JUN; CCNB1;