SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30206_T100-Biotin
Size:100ul
Price: $384.00
SKU
ARP30206_T100-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)

Datasheets/ManualsPrintable datasheet for anti-RAD17 (ARP30206_T100-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human RAD17
Predicted Homology Based on Immunogen SequenceCow: 83%; Dog: 75%; Human: 100%; Mouse: 75%; Pig: 83%; Rat: 75%
Peptide SequenceSynthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Concentration0.5 mg/ml
Blocking PeptideFor anti-RAD17 (ARP30206_T100-Biotin) antibody is Catalog # AAP30206 (Previous Catalog # AAPS09009)
Sample Type Confirmation

RAD17 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceTsao,C.C., (2004) EMBO J. 23 (23), 4660-4669
Gene SymbolRAD17
Gene Full NameRAD17 homolog (S. pombe)
Alias SymbolsCCYC, R24L, RAD24, HRAD17, RAD17SP
NCBI Gene Id5884
Protein NameCell cycle checkpoint protein RAD17
Description of TargetRAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported.
Uniprot IDO75943-4
Protein Accession #NP_579919
Nucleotide Accession #NM_133341
Protein Size (# AA)584
Molecular Weight66kDa
Protein InteractionsUSP20; UBC; PRMT6; CBX7; CBX6; RAD9A; CDH1; ATR; RFC1; H2AFX; FOXO3; ATM; CLSPN; ALK; RAD9B; POLE; HUS1; RAD1; NHP2L1; MCM7; RFC4; RFC5; RFC3; RFC2; POLE4; POLE3; POLE2; PRKDC;
  1. What is the species homology for "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig".

  2. How long will it take to receive "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)"?

    This target may also be called "CCYC, R24L, RAD24, HRAD17, RAD17SP" in publications.

  5. What is the shipping cost for "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RAD17"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RAD17"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RAD17"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RAD17"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RAD17"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RAD17"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RAD17 Antibody - C-terminal region : Biotin (ARP30206_T100-Biotin)
Your Rating
We found other products you might like!