PWP2 Antibody - middle region (ARP45822_P050)

Catalog No: ARP45822_P050

WB Suggested Anti-PWP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Host: Rabbit
Target Name: PWP2
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlPWP2 is supported by BioGPS gene expression data to be expressed in Jurkat

Host: Rabbit
Target Name: PWP2
Sample Type: MCF7
Antibody Dilution: 1.0ug/mlPWP2 is supported by BioGPS gene expression data to be expressed in MCF7

Host: Rabbit
Target Name: PWP2
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlPWP2 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PWP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PWP2 (ARP45822_P050) antibody is Catalog # AAP45822 (Previous Catalog # AAPP26760)
• Sample Type Confirmation:

  PWP2 is supported by BioGPS gene expression data to be expressed in 721_B, Jurkat MCF7

• Reference: Scherl,A., (2002) Mol. Biol. Cell 13 (11), 4100-4109
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Target Info

• Gene Symbol: PWP2
• Gene Full Name: PWP2 periodic tryptophan protein homolog (yeast)
• Alias Symbols: UTP1, PWP2H, EHOC-17
• NCBI Gene Id: 5822
• Protein Name: Periodic tryptophan protein 2 homolog
• Description of Target: PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.
• Uniprot ID: Q15269
• Protein Accession #: NP_005040
• Nucleotide Accession #: NM_005049
• Protein Size (# AA): 919
• Molecular Weight: 102kDa
• Protein Interactions: CUL3; UBC; EED; RNF2; HECW2; TARDBP; MMS19; WDR36; IPO13; RRP9; CUL1; SIRT7; SUMO2; HDGF; USP36; TOM1L1;