- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PSMB9 (ARP46081_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PSMB9 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PSMB9 (ARP46081_P050) antibody is Catalog # AAP46081 (Previous Catalog # AAPP26943) |
Sample Type Confirmation | PSMB9 is supported by BioGPS gene expression data to be expressed in Jurkat |
Subunit | beta type-9 |
Reference | Deshpande,A., (2008) J. Infect. Dis. 197 (3), 371-381 |
Gene Symbol | PSMB9 |
---|---|
Gene Full Name | Proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) |
Alias Symbols | LMP2, PRAAS3, PSMB6i, RING12, beta1i |
NCBI Gene Id | 5698 |
Protein Name | Proteasome subunit beta type-9 |
Description of Target | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMB9 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This subunit is involved in antigen processing to generate class I binding peptides. Expression of PSMB9 is induced by gamma interferon and it replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding different isoforms have been identified; both isoforms are processed to yield the same mature subunit. |
Uniprot ID | P28065 |
Protein Accession # | NP_002791 |
Nucleotide Accession # | NM_002800 |
Protein Size (# AA) | 219 |
Molecular Weight | 23 kDa |
Protein Interactions | NCOA3; TCEB3; SRC; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; POLR2C; POLR2B; ESR1; NCOA2; UBC; HCVgp1; PSMA2; PSMB5; PSME2; PSME1; PSMB6; PSMA3; POMP; PSMB8; PSMB7; PSMA7; PSMA1; PSMB9; PSMC5; PSMA4; POLR2A; NCOA1; PSMB10; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PSMB9 Antibody - C-terminal region (ARP46081_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".
-
How long will it take to receive "PSMB9 Antibody - C-terminal region (ARP46081_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "PSMB9 Antibody - C-terminal region (ARP46081_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PSMB9 Antibody - C-terminal region (ARP46081_P050)"?
This target may also be called "LMP2, PRAAS3, PSMB6i, RING12, beta1i" in publications.
-
What is the shipping cost for "PSMB9 Antibody - C-terminal region (ARP46081_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PSMB9 Antibody - C-terminal region (ARP46081_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PSMB9 Antibody - C-terminal region (ARP46081_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "23 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PSMB9 Antibody - C-terminal region (ARP46081_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PSMB9"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PSMB9"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PSMB9"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PSMB9"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PSMB9"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PSMB9"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.