website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

PSMA3 antibody - middle region (ARP57742_P050)

Description of Target:
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Gene Symbol:
PSMA3
Official Gene Full Name:
Proteasome (prosome, macropain) subunit, alpha type, 3
NCBI Gene Id:
5684
Alias Symbols:
HC8; MGC12306; MGC32631; PSC3
Tissue Tool:
Find tissues and cell lines supported to express PSMA3.
Protein Accession #:
NP_687033
Nucleotide Accession#:
NM_152132
Swissprot Id:
P25788-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Proteasome subunit alpha type-3
Protein Size (# AA):
248
Molecular Weight:
28kDa
Application:
WB
Subunit:
alpha type-3
Partner Proteins:
ATN1, AURKB, BAT2, CDKN1A, CRYAB, CSNK2A1, EGR1, GFI1B, HHEX, PLK1, PRNP, PSMA1, PSMA2, PSMA4, PSMA6, PSMA7, PSMB5, RERE, SNRPB, SNRPF, STUB1, STX11, XRN2, BAT2, CDKN1A, CRYAB, EGR1, GIYD2, PLK1, PSMA1, PSMA6, PSMD13, PSMD14, SNRPB, SNRPF, STX11, TRIB3, XRN2
Immunogen:
The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
PSMA3 antibody - middle region (ARP57742_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 92%; Rabbit: 92%; Yeast: 77%; Zebrafish: 77%
Species Reactivity:
Mouse, Dog, Pig, Horse, Human, Guinea pig, Bovine, Rabbit, Rat, Zebrafish, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-PSMA3 antibody
- ARP57742_P050
Peptide Sequence:
Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
Blocking Peptide:
For anti-PSMA3 antibody is Catalog # AAP57742 (Previous Catalog # AAPP35445)
Key Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-PSMA3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question