- Description of Target:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
- Gene Symbol:
- PSMA3
- Official Gene Full Name:
- Proteasome (prosome, macropain) subunit, alpha type, 3
- Alias Symbols:
- HC8; MGC12306; MGC32631; PSC3
- Tissue Tool:
- Find tissues and cell lines supported to express PSMA3.

- Protein Accession# :
- NP_687033
- Nucleotide Accession#:
- NM_152132
- Swissprot Id:
- P25788-2
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 248
- Molecular Weight:
- 28kDa
- Application:
- WB
- Subunit:
- alpha type-3
- Partner Proteins:
- ATN1, AURKB, BAT2, CDKN1A, CRYAB, CSNK2A1, EGR1, GFI1B, HHEX, PLK1, PRNP, PSMA1, PSMA2, PSMA4, PSMA6, PSMA7, PSMB5, RERE, SNRPB, SNRPF, STUB1, STX11, XRN2, BAT2, CDKN1A, CRYAB, EGR1, GIYD2, PLK1, PSMA1, PSMA6, PSMD13, PSMD14, SNRPB, SNRPF, STX11, TRIB3, XRN2
- Immunogen:
- The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- PSMA3 antibody - middle region (ARP57742_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 100%; Human: 100%; Mouse: 100%; African clawed frog: 92%; Chicken: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 76%
- Datasheets / Downloads:
- Printable datasheet for
anti-PSMA3 antibody
- ARP57742_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
- Blocking Peptide:
- For anti-PSMA3 antibody is Catalog # AAP57742 (Previous Catalog # AAPP35445)
- Key Reference:
- Olsen,J.V., (2006) Cell 127 (3), 635-648
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-PSMA3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: PSMA3 antibody tested with Human 293T Cells (ARP57742_P050)
Aviva Systems Biology is the original manufacturer of this PSMA3 antibody (ARP57742_P050)
Click here to view the PSMA3 antibody Western Blot Protocol
Product Datasheet Link: PSMA3 antibody (ARP57742_P050)
WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T
Western Blot image: 
Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s PSMA3 antibody (ARP57742_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


