website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/5/2016.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PSMA3 antibody - middle region (ARP57742_P050)

  • Catalog#: ARP57742_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock
    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    PSMA3
    NCBI Gene Id:
    5684
    Official Gene Full Name:
    Proteasome (prosome, macropain) subunit, alpha type, 3
    Protein Name:
    Proteasome subunit alpha type-3
    Swissprot Id:
    P25788-2
    Protein Accession #:
    NP_687033
    Nucleotide Accession #:
    NM_152132
    Alias Symbols:
    HC8, MGC12306, MGC32631, PSC3
    Replacement Item:
    This antibody may replace item sc-166205 from Santa Cruz Biotechnology.
    Description of Target:
    The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
    Protein Size (# AA):
    248
    Molecular Weight:
    28kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express PSMA3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express PSMA3.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human PSMA3
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%; Yeast: 77%; Zebrafish: 77%
    Complete computational species homology data:
    Anti-PSMA3 (ARP57742_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    SF1; STX4; SNRPC; SNRPB; RAB3IL1; PSMB4; PSMA6; PSMA3; PSMA1; NPPB; CTAGE5; LETM1; LASP1; KRAS; NPBWR2; GATA3; GATA2; CYBA; CST2; CDK6; ATP6V0C; DMC1; SLMO1; BTN2A2; STX6; SERF2; HUWE1; APLN; C1QTNF9B-AS1; C9orf106; KRTAP26-1; KRTAP19-5; KRTAP8-1; RTP5; R
    Blocking Peptide:
    For anti-PSMA3 (ARP57742_P050) antibody is Catalog # AAP57742 (Previous Catalog # AAPP35445)
    Datasheets / Downloads:
    Printable datasheet for anti-PSMA3 (ARP57742_P050) antibody
    Subunit:
    alpha type-3
    Target Reference:
    Olsen,J.V., (2006) Cell 127 (3), 635-648

    Product Protocols: PSMA3 antibody tested with Human 293T Cells (ARP57742_P050)

    Aviva Systems Biology is the original manufacturer of this PSMA3 antibody (ARP57742_P050)

    Click here to view the PSMA3 antibody Western Blot Protocol

    Product Datasheet Link: PSMA3 antibody (ARP57742_P050)

    WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: 293T

    Western Blot image:


    Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s PSMA3 antibody (ARP57742_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question