website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

PSMA3 antibody - middle region (ARP57742_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Proteasome (prosome, macropain) subunit, alpha type, 3
    Protein Name:
    Proteasome subunit alpha type-3
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    HC8, MGC12306, MGC32631, PSC3
    Description of Target:
    The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express PSMA3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express PSMA3.
    The immunogen is a synthetic peptide directed towards the middle region of human PSMA3
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%; Yeast: 77%; Zebrafish: 77%
    Complete computational species homology data:
    Anti-PSMA3 (ARP57742_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-PSMA3 (ARP57742_P050) antibody is Catalog # AAP57742 (Previous Catalog # AAPP35445)
    Datasheets / Downloads:
    Printable datasheet for anti-PSMA3 (ARP57742_P050) antibody
    alpha type-3
    Target Reference:
    Olsen,J.V., (2006) Cell 127 (3), 635-648

    Product Protocols: PSMA3 antibody tested with Human 293T Cells (ARP57742_P050)

    Aviva Systems Biology is the original manufacturer of this PSMA3 antibody (ARP57742_P050)

    Click here to view the PSMA3 antibody Western Blot Protocol

    Product Datasheet Link: PSMA3 antibody (ARP57742_P050)

    WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: 293T

    Western Blot image:

    Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s PSMA3 antibody (ARP57742_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question