website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

PSMA3 antibody - middle region (ARP57742_P050)

Description of Target:
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Gene Symbol:
Official Gene Full Name:
Proteasome (prosome, macropain) subunit, alpha type, 3
NCBI Gene Id:
Alias Symbols:
HC8; MGC12306; MGC32631; PSC3
Tissue Tool:
Find tissues and cell lines supported to express PSMA3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Proteasome subunit alpha type-3
Protein Size (# AA):
Molecular Weight:
alpha type-3
Protein Interactions:
The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
PSMA3 antibody - middle region (ARP57742_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 92%; Rabbit: 92%; Yeast: 77%; Zebrafish: 77%
Species Reactivity:
Mouse, Dog, Pig, Horse, Human, Guinea pig, Bovine, Rabbit, Rat, Zebrafish, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-PSMA3 antibody
- ARP57742_P050
Peptide Sequence:
Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
Blocking Peptide:
For anti-PSMA3 antibody is Catalog # AAP57742 (Previous Catalog # AAPP35445)
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for PSMA3 antibody (ARP57742)

Product page for PSMA3 antibody (ARP57742)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog MGC68557 antibody; Xenopus laevis MGC68557 antibody Q6PE96 84%
African clawed frog psma3 antibody; Xenopus laevis psma3 antibody Q8AVD2 92%
African elephant LOC100668345 antibody; Loxodonta africana LOC100668345 antibody G3T287 100%
American bullfrog PSA3 antibody; Rana catesbeiana PSA3 antibody C1C4L6 92%
Atlantic salmon PSA3 antibody; Salmo salar PSA3 antibody B5XGG8 78%
Atlantic salmon PSA3 antibody; Salmo salar PSA3 antibody B5X5D8 78%
Atlantic salmon PSA3 antibody; Salmo salar PSA3 antibody B5XGI9 78%
blue catfish PSA3 antibody; Ictalurus furcatus PSA3 antibody E3TC48 84%
Bovine PSA3 antibody; Bos taurus PSA3 antibody Q58DU5 92%
Channel catfish psa3 antibody; Ictalurus punctatus psa3 antibody E3TEB7 84%
Chicken PSMA3 antibody; Gallus gallus PSMA3 antibody Q5ZLI2 92%
Common turkey PSMA3 antibody; Meleagris gallopavo PSMA3 antibody G3US23 92%
Common turkey PSMA3 antibody; Meleagris gallopavo PSMA3 antibody G1NLJ2 92%
Dog PSMA3 antibody; Canis familiaris PSMA3 antibody E2RKR4 100%
Duckbill platypus PSMA3 antibody; Ornithorhynchus anatinus PSMA3 antibody F7ARD0 92%
Duckbill platypus PSMA3 antibody; Ornithorhynchus anatinus PSMA3 antibody F7ARB8 92%
Giant panda LOC100468723 antibody; Ailuropoda melanoleuca LOC100468723 antibody G1L6X6 100%
Gray short-tailed opossum PSMA3 antibody; Monodelphis domestica PSMA3 antibody F7ETB2 100%
Guinea pig LOC100736221 antibody; Cavia porcellus LOC100736221 antibody H0V721 100%
Horse LOC100050987 antibody; Equus caballus LOC100050987 antibody F7ANR3 100%
Human PSA3 antibody; Homo sapiens PSA3 antibody P25788 100%
Human PSA3 antibody; Homo sapiens PSA3 antibody P25788-2 100%
Human PSMA3 antibody; Homo sapiens PSMA3 antibody Q6IB71 100%
Human PSMA3 antibody; Homo sapiens PSMA3 antibody H0YJ03 100%
Human PSMA3 antibody; Homo sapiens PSMA3 antibody G3V4X5 100%
Kenyan clawed frog psma3alpha antibody; Xenopus borealis psma3alpha antibody B2L4K8 92%
Kenyan clawed frog psma3beta antibody; Xenopus borealis psma3beta antibody B2L4K9 85%
Little brown bat PSMA3 antibody; Myotis lucifugus PSMA3 antibody G1P9M0 100%
Lowland gorilla PSMA3 antibody; Gorilla gorilla gorilla PSMA3 antibody G3RID0 100%
Mouse PSA3 antibody; Mus musculus PSA3 antibody O70435 100%
Mouse Psma3 antibody; Mus musculus Psma3 antibody Q9DCD8 100%
Mouse Psma3 antibody; Mus musculus Psma3 antibody Q58EV4 100%
Mouse Psma3 antibody; Mus musculus Psma3 antibody Q3TEL1 100%
Northern white-cheeked gibbon LOC100601171 antibody; Nomascus leucogenys LOC100601171 antibody G1RRR8 100%
Pig LOC100154408 antibody; Sus scrofa LOC100154408 antibody F1SSL6 100%
Rabbit LOC100338517 antibody; Oryctolagus cuniculus LOC100338517 antibody G1SZ14 92%
Rabbit PSMA3 antibody; Oryctolagus cuniculus PSMA3 antibody G1U0N1 92%
Rainbow smelt PSA3 antibody; Osmerus mordax PSA3 antibody C1BLU4 92%
Rainbow trout PSA3 antibody; Oncorhynchus mykiss PSA3 antibody C1BEL6 78%
Rainbow trout PSA3 antibody; Oncorhynchus mykiss PSA3 antibody C1BF68 78%
Rat PSA3 antibody; Rattus norvegicus PSA3 antibody P18422 92%
Rat Psma3l antibody; Rattus norvegicus Psma3l antibody Q6IE67 92%
Rhesus macaque PSMA3 antibody; Macaca mulatta PSMA3 antibody F7E2S4 100%
Sablefish PSA3 antibody; Anoplopoma fimbria PSA3 antibody C3KI17 85%
Sablefish PSA3 antibody; Anoplopoma fimbria PSA3 antibody C3KHE2 85%
Small-eared galago PSMA3 antibody; Otolemur garnettii PSMA3 antibody H0WGA7 100%
Tasmanian devil PSMA3 antibody; Sarcophilus harrisii PSMA3 antibody G3X0H5 100%
Western clawed frog LOC100135338 antibody; Xenopus tropicalis LOC100135338 antibody A9UMF5 76%
Western clawed frog psma3 antibody; Xenopus tropicalis psma3 antibody Q5PPP6 92%
Western clawed frog psma3 antibody; Xenopus tropicalis psma3 antibody F6XZS3 92%
White-tufted-ear marmoset LOC100388032 antibody; Callithrix jacchus LOC100388032 antibody F7EMD2 100%
White-tufted-ear marmoset LOC100398028 antibody; Callithrix jacchus LOC100398028 antibody F7IS34 100%
Zebra finch PSMA3 antibody; Taeniopygia guttata PSMA3 antibody H0ZS32 92%
Zebrafish psma3 antibody; Danio rerio psma3 antibody Q4V918 76%
Zebrafish psma3 antibody; Danio rerio psma3 antibody A7MCA2 76%

Product Protocols: PSMA3 antibody tested with Human 293T Cells (ARP57742_P050)

Aviva Systems Biology is the original manufacturer of this PSMA3 antibody (ARP57742_P050)

Click here to view the PSMA3 antibody Western Blot Protocol

Product Datasheet Link: PSMA3 antibody (ARP57742_P050)

WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T

Western Blot image:

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s PSMA3 antibody (ARP57742_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question