PPIA protein (GST tagged) (Full length) (Human) (100μg)

Catalog#: AEP10003

• Size: 100ug

Human PPIA

• Description of Target: This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.
• Gene Symbol: PPIA
• Alias Symbols: CYPA; CYPH; MGC12404; MGC23397; MGC117158; PPIA
• Protein Accession#: NP_066953
• Nucleotide Accession#: NM_021130
• Swissprot Id: P62937
• Protein Size (# AA): 165
• Molecular Weight: 18kDa
• Product Format: Lyophilized powder
• Protein Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
• Reconstitution and Storage: Already in solution (1mg/ml). For longer periods of storage, store at -20°C. Avoid repeat freeze and thaw cycles.
• Key Reference: N/A